Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: burce-lipad

Burkholderia cepacia (Pseudomonas cepacia) lipD triacylglycerol lipase (EC 3.1.1.3)

Comment
the sequence from Sugihara et al. P29605 is short and full of X


Relationship
Family|Bacterial_lip_FamI.2
Block| L
Position in NCBI Life Tree|Burkholderia cepacia
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Burkholderiaceae: N E > Burkholderia: N E > Burkholderia cepacia complex: N E > Burkholderia cepacia: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : A16316
1 Ncbi-nid : 512513
1 Ncbi-pid : 512514
1 UniProt : P29605
1 Interpro : P29605
1 Prodom : P29605
1 Pfam : P29605
1 PIRSF : P29605
1 SUPERFAM : P29605
Sequence
Graphical view for this peptide sequence: burce-lipad
Colored MSA for Bacterial_lip_FamI.2 (raw)
MARSMRSRVVAGAVACAMSVAPFAGATAVMTLATTHAAMAATAPADDYAT
TRYPIILVHGLTGTDKYAGVLEYWYGIQEDLQQHGATVYVANLSGFQSDD
GPNGRGEQLLAYVKTVLAATGATKVNLVGHXQGGLTSRYVAAVAPDLVAS
VTTIGTPHRAXEFADFVQGVLAYDPTGLSSSVIAAFVNVFGILTSSSHNT
NQDALASLKTLTTAQAAAYNQNYPSAGLGAPGSCQTGXPTETVRXNTHLL
YSWAGTAIQPTLSVFGVTGATDTSTIPLVDPANALDPSTLALFGTGTVMI
NRGSGPNDGLVSKCSALYGQVLSTSYKWNHIDEINQLLGVRGANAEDPVA
VIRTHANRLKLAGV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MARSMRSRVVAGAVACAMSVAPFAGATAVMTLATTHAAMAATAPADDYAT
TRYPIILVHGLTGTDKYAGVLEYWYGIQEDLQQHGATVYVANLSGFQSDD
GPNGRGEQLLAYVKTVLAATGATKVNLVGHXQGGLTSRYVAAVAPDLVAS
VTTIGTPHRAXEFADFVQGVLAYDPTGLSSSVIAAFVNVFGILTSSSHNT
NQDALASLKTLTTAQAAAYNQNYPSAGLGAPGSCQTGXPTETVRXNTHLL
YSWAGTAIQPTLSVFGVTGATDTSTIPLVDPANALDPSTLALFGTGTVMI
NRGSGPNDGLVSKCSALYGQVLSTSYKWNHIDEINQLLGVRGANAEDPVA
VIRTHANRLKLAGV


Reference
    Title: Purification and characterization of a novel thermostable lipase from Pseudomonas cepacia
    Sugihara A, Ueshima, M, Shimada Y, Tsunasawa S, Tominaga Y
    Ref: Journal of Biochemistry, 112 (5):598, 1992 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer