Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: chrvi-PCAD

Chromobacterium violaceum 3-oxoadipate enol-lactonase (EC 3.1.1.24)

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Chromobacterium violaceum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Neisseriales: N E > Chromobacteriaceae: N E > Chromobacterium group: N E > Chromobacterium: N E > Chromobacterium violaceum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AE016914
1 UniProt : Q7NYE3
1 Interpro : Q7NYE3
1 Pfam : Q7NYE3
1 PIRSF : Q7NYE3
1 SUPERFAM : Q7NYE3
Sequence
Graphical view for this peptide sequence: chrvi-PCAD
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MPHAQLAGYQVYYEESGHGSQPLLLLNGITMSTVGWTLMMPLLEPHFRVI
RMDFLGQGQSEHPPGELYALADQADLAAALLDWLQLPQAYVAGLSYGGMV
AQHLAHRHPGRLSRLLLAGTLAWADTVNHHIGDSWIAANNQGGLDLRYQV
SVPWLFSSRFLAGNAAMLDDLKLLAGMVDWDAVIRLINGVRQHDARTWLP
QLQLPVHILVGDEDRLTPLYQARLLQELIPGAELEVLPGAAHVLHIEAVE
AFARAIVRFRQD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPHAQLAGYQVYYEESGHGSQPLLLLNGITMSTVGWTLMMPLLEPHFRVI
RMDFLGQGQSEHPPGELYALADQADLAAALLDWLQLPQAYVAGLSYGGMV
AQHLAHRHPGRLSRLLLAGTLAWADTVNHHIGDSWIAANNQGGLDLRYQV
SVPWLFSSRFLAGNAAMLDDLKLLAGMVDWDAVIRLINGVRQHDARTWLP
QLQLPVHILVGDEDRLTPLYQARLLQELIPGAELEVLPGAAHVLHIEAVE
AFARAIVRFRQD


Reference
    Title: The complete genome sequence of Chromobacterium violaceum reveals remarkable and exploitable bacterial adaptability
    Ribeiro de Vasconcelos AT, Brazilian National Genome Project Consortium
    Ref: Proceedings of the National Academy of Sciences of the United States of America, 100:11660, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer