Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: citsi-a0a067dfs3

Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). Uncharacterized protein

Comment
Other strains: Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis), Citrus clementina


Relationship
Family|Pectinacetylesterase-Notum
Block| X
Position in NCBI Life Tree|Citrus sinensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Sapindales: N E > Rutaceae: N E > Aurantioideae: N E > Citrus: N E > Citrus sinensis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: citsi-a0a067dfs3
Colored MSA for Pectinacetylesterase-Notum (raw)
MNSLCASLLFYYPYFYWYVVFCVFPYIMFIIFFLDILRMVAARMGQWLNL
LVCALILLKADGFNVGITYVENAVVKGAVCLDGSPPAYHFDKGFGAGINN
WLVHIEGGGWCNNVTTCLERKKTRLGSSKQMVKVVAFSGMLSNKQKFNPD
FYNWNRIKVRYCDGASFTGDVEAVNPANNLHFRGARVFQAVMEDLMAKGM
KNAQNAVLSGCSAGGLTSILHCDNFRALFPVGTKVKCFADAGYFINAKDV
SGASHIEQFYAQVVATHGSAKHLPASCTSRLSPGLCFFPQYMARQITTPL
FIINAAYDSWQIKNILAPGVADPHGTWHSCKLDINNCSPTQLQTMQSFRT
QFLNALAGLGISSSRGMFIDACYAHCQTEMQETWLRTDSPVLGKMSIAKA
VGDWYYDRSPFQKIDCAYPCNPTCHNRVFDSNVHSEV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNSLCASLLFYYPYFYWYVVFCVFPYIMFIIFFLDILRMVAARMGQWLNL
LVCALILLKADGFNVGITYVENAVVKGAVCLDGSPPAYHFDKGFGAGINN
WLVHIEGGGWCNNVTTCLERKKTRLGSSKQMVKVVAFSGMLSNKQKFNPD
FYNWNRIKVRYCDGASFTGDVEAVNPANNLHFRGARVFQAVMEDLMAKGM
KNAQNAVLSGCSAGGLTSILHCDNFRALFPVGTKVKCFADAGYFINAKDV
SGASHIEQFYAQVVATHGSAKHLPASCTSRLSPGLCFFPQYMARQITTPL
FIINAAYDSWQIKNILAPGVADPHGTWHSCKLDINNCSPTQLQTMQSFRT
QFLNALAGLGISSSRGMFIDACYAHCQTEMQETWLRTDSPVLGKMSIAKA
VGDWYYDRSPFQKIDCAYPCNPTCHNRVFDSNVHSEV



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer