Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cocap-a0a1r3ibd6

Corchorus capsularis (Jute); Corchorus olitorius Alpha/beta hydrolase-1

Comment
Other strains: Corchorus capsularis; Corchorus olitorius


Relationship
Family|Bodyguard
Block| X
Position in NCBI Life Tree|Corchorus capsularis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Malvales: N E > Malvaceae: N E > Grewioideae: N E > Apeibeae: N E > Corchorus: N E > Corchorus capsularis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 UniProt : A0A1R3IBD6, A0A1R3K6V9
2 Interpro : A0A1R3IBD6, A0A1R3K6V9
2 Prodom : A0A1R3IBD6, A0A1R3K6V9
2 Pfam : A0A1R3IBD6, A0A1R3K6V9
2 PIRSF : A0A1R3IBD6, A0A1R3K6V9
2 SUPERFAM : A0A1R3IBD6, A0A1R3K6V9
Sequence
Graphical view for this peptide sequence: cocap-a0a1r3ibd6
Colored MSA for Bodyguard (raw)
MGVMCKIRSVLTLVGDVLNKAVSFIVFCFLDLLDFILCFVYKVADFFIEA
EWKPCYCSSAKEAITGSGKILVSEQGESKVVCLTSSKLQLEDISDTLYSR
PSLVTEVSKLTVTELKKLKLDGTIIQSCEKVKKGTVRSTFTINSTIVEML
QGKMVGQQLHPIPRWSDCDCKFCNSWTSSSKDTLFVKAQGPKDKAREDVL
FIHGFISSSAFWSETLFPNFSTSAKSTYRLLAVDLLGFGRSPKPTDSLYT
LREHVDMIEKSVLDAYKVKSFHIVAHSLGCILALAIAVKHPGSVKSLTLL
APPYFPVPKGEPATQYVMRKLAPRRVWPVMAFCSSIACWYEHISRTVCLL
ICKNHRLWEFLTKLVTRNRIRTFLLEGFFCHTHNAAWHTLHNIICGTASK
LDSYLDAVRDRLKCDVTIFHGKDDEVIPLECSYDVQRRIPRARVKVVENK
DHITIVVGRQKAFARELEEIWKGSPKD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGVMCKIRSVLTLVGDVLNKAVSFIVFCFLDLLDFILCFVYKVADFFIEA
EWKPCYCSSAKEAITGSGKILVSEQGESKVVCLTSSKLQLEDISDTLYSR
PSLVTEVSKLTVTELKKLKLDGTIIQSCEKVKKGTVRSTFTINSTIVEML
QGKMVGQQLHPIPRWSDCDCKFCNSWTSSSKDTLFVKAQGPKDKAREDVL
FIHGFISSSAFWSETLFPNFSTSAKSTYRLLAVDLLGFGRSPKPTDSLYT
LREHVDMIEKSVLDAYKVKSFHIVAHSLGCILALAIAVKHPGSVKSLTLL
APPYFPVPKGEPATQYVMRKLAPRRVWPVMAFCSSIACWYEHISRTVCLL
ICKNHRLWEFLTKLVTRNRIRTFLLEGFFCHTHNAAWHTLHNIICGTASK
LDSYLDAVRDRLKCDVTIFHGKDDEVIPLECSYDVQRRIPRARVKVVENK
DHITIVVGRQKAFARELEEIWKGSPKD



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer