Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: color-n4v423

Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) (Cucumber anthracnose fungus) (Colletotrichum lagenarium) Lipase b

Relationship
Family|Canar_LipB
Block| L
Position in NCBI Life Tree|Colletotrichum orbiculare
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Glomerellales: N E > Glomerellaceae: N E > Colletotrichum: N E > Colletotrichum orbiculare: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KB725947
1 UniProt : N4V423
1 UniProt : N4V423
1 Interpro : N4V423
1 Pfam : N4V423
1 PIRSF : N4V423
1 SUPERFAM : N4V423
Sequence
Graphical view for this peptide sequence: color-n4v423
Colored MSA for Canar_LipB (raw)
MKTTGATILALACGWTGVLARPVTEPKPTVGEIIAKNQTVAQADWEMQAD
TWWKHKGDKKAAKKAGPKSAVQTVNSMNNANPAPMVQIYPKRSPQDAPYS
LSEQELRSKIYIPKTFSAASGKQPVILIPGTAAMAGTTYTANLGPLLAGS
DFGDPLWVNIPEASLGDAQVNSEYVAYAMNYVQSYTGRKAAVVAWSQGNL
NVQWALKYWPSTREAVTDLVAMSPDFHGTKEALAVCDTAARVIGCTPSVY
QQEYKSMFIEKLRAQGGNNAYVPTTSIYSATDQIVQPQSGPMASAILGDG
NGVPVSNIEIQKACPGTVAGGEVTHEGMLYNAMAFALLRDAVMNDGPGRV
ERIDKKVCLDPAAGNLDGARIKATEAVLASAAVNIMRYPVRVKAEPAIKP
YAL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKTTGATILALACGWTGVLARPVTEPKPTVGEIIAKNQTVAQADWEMQAD
TWWKHKGDKKAAKKAGPKSAVQTVNSMNNANPAPMVQIYPKRSPQDAPYS
LSEQELRSKIYIPKTFSAASGKQPVILIPGTAAMAGTTYTANLGPLLAGS
DFGDPLWVNIPEASLGDAQVNSEYVAYAMNYVQSYTGRKAAVVAWSQGNL
NVQWALKYWPSTREAVTDLVAMSPDFHGTKEALAVCDTAARVIGCTPSVY
QQEYKSMFIEKLRAQGGNNAYVPTTSIYSATDQIVQPQSGPMASAILGDG
NGVPVSNIEIQKACPGTVAGGEVTHEGMLYNAMAFALLRDAVMNDGPGRV
ERIDKKVCLDPAAGNLDGARIKATEAVLASAAVNIMRYPVRVKAEPAIKP
YAL


Reference
    Title: Comparative genomic and transcriptomic analyses reveal the hemibiotrophic stage shift of Colletotrichum fungi
    Gan P, Ikeda K, Irieda H, Narusaka M, O'Connell RJ, Narusaka Y, Takano Y, Kubo Y, Shirasu K
    Ref: New Phytol, 197:1236, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer