Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cupnn-f8gp18

Cupriavidus necator (strain ATCC 43291 / DSM 13513 / N-1) (Ralstonia eutropha) Dienelactone hydrolase

Relationship
Family|DLH-S
Block| X
Position in NCBI Life Tree|Cupriavidus necator
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Burkholderiaceae: N E > Cupriavidus: N E > Cupriavidus necator: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP002878
1 UniProt : F8GP18
1 UniProt : F8GP18
1 Interpro : F8GP18
1 Pfam : F8GP18
1 PIRSF : F8GP18
1 SUPERFAM : F8GP18
Sequence
Graphical view for this peptide sequence: cupnn-f8gp18
Colored MSA for DLH-S (raw)
MRSNSEAIEVVIPAGGVDLQGILTLPPGAVALVLFAHGTGSSRLSPRNRY
VAAELNRCGMATLLMDLLLPEEDQVQAIRFDVELLATRLAQATSWVARQQ
AVPQRFGYFGASVGGAASIRAACQSPIPIHAVVSRGGRVDLAGPDALAKL
LAPTMLIIGGLDLSVLERNESAYAQLTCTKKLVIVPGASHLFEEPGALES
VARLAAQWFERYLGKDSP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRSNSEAIEVVIPAGGVDLQGILTLPPGAVALVLFAHGTGSSRLSPRNRY
VAAELNRCGMATLLMDLLLPEEDQVQAIRFDVELLATRLAQATSWVARQQ
AVPQRFGYFGASVGGAASIRAACQSPIPIHAVVSRGGRVDLAGPDALAKL
LAPTMLIIGGLDLSVLERNESAYAQLTCTKKLVIVPGASHLFEEPGALES
VARLAAQWFERYLGKDSP


Reference
    Title: Complete genome sequence of the type strain Cupriavidus necator N-1
    Poehlein A, Kusian B, Friedrich B, Daniel R, Bowien B
    Ref: Journal of Bacteriology, 193:5017, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer