Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: geotm-a0a023drk1

Geobacillus thermoglucosidasius; Geobacillus caldoxylosilyticus Putative carboxylesterase

Comment
Other strains: Geobacillus thermoglucosidasius (NBRC 107763; C56-YS93; NUB3621); Geobacillus caldoxylosilyticus NBRC 107762


Relationship
Family|CarbLipBact_1
Block| X
Position in NCBI Life Tree|Geobacillus thermoglucosidasius
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Parageobacillus: N E > Parageobacillus thermoglucosidasius: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: geotm-a0a023drk1
Colored MSA for CarbLipBact_1 (raw)
MKVVPPKPFTFEAGERAVLLLHGFTGNSSDVRMLGRFLEAKGYTCHAPIY
KGHGVPPEELVHTGPDDWWQDVINAYEFLKNKGYEKIAVAGLSLGGVFSL
KLGYTVPVVGIIPMCAPMYIKSEETMYEGVLKYAREYKKREGKTPEQIEE
EMEAFQKTPMKTLKALQQLIADVRERIDLIYAPTFVVQARHDEMINPDSA
NIIYNGIESPVKKIKWYEESGHVITLDKEKEQLHEDIYEFLESLDW
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKVVPPKPFTFEAGERAVLLLHGFTGNSSDVRMLGRFLEAKGYTCHAPIY
KGHGVPPEELVHTGPDDWWQDVINAYEFLKNKGYEKIAVAGLSLGGVFSL
KLGYTVPVVGIIPMCAPMYIKSEETMYEGVLKYAREYKKREGKTPEQIEE
EMEAFQKTPMKTLKALQQLIADVRERIDLIYAPTFVVQARHDEMINPDSA
NIIYNGIESPVKKIKWYEESGHVITLDKEKEQLHEDIYEFLESLDW


Reference
    Title: Transformable facultative thermophile Geobacillus stearothermophilus NUB3621 as a host strain for metabolic engineering
    Blanchard K, Robic S, Matsumura I
    Ref: Applied Microbiology & Biotechnology, 98:6715, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer