Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: hydvu-t2mb74

Hydra vulgaris (Hydra) (Hydra attenuata). Protein notum homolog

Relationship
Family|Pectinacetylesterase-Notum
Block| X
Position in NCBI Life Tree|Hydra vulgaris
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Cnidaria: N E > Hydrozoa: N E > Hydroidolina: N E > Anthoathecata: N E > Aplanulata: N E > Hydridae: N E > Hydra: N E > Hydra vulgaris: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : HAAD01003167
1 UniProt : T2MB74
1 UniProt : T2MB74
1 Interpro : T2MB74
1 Pfam : T2MB74
1 PIRSF : T2MB74
1 SUPERFAM : T2MB74
Sequence
Graphical view for this peptide sequence: hydvu-t2mb74
Colored MSA for Pectinacetylesterase-Notum (raw)
TFSKNSRMYFIQTISFCVIIRMCIANPIPIVTNGSSKQQTDCLAEMERVF
LMDEKITCNDGSKSGYYLRENQNSEDWIIYLEGGWFCHNEASCTTRMNHS
SLFSMTSSKLWHDCRKGDGMVHPDSNSNPLFYHYNHVYVPYCSSDFWLGN
TNQITSKGENIAFHGSKILIRLITELLNKRLAKASTLVLAGSSAGGIGVL
QNIDRVAKIVQTLKPNIEVKGIIDSAYFLEASLNSNCKSDGCNNSDLELK
LATSYWGALLDSTCDKGYRCLFAENMLLTVKTPIFMFQWLYDTVQIMADN
RALETHLDEIFQPENMAFVLKLGEKMRKLLKESDERIGLFAPSCIAHTAL
ASSSVFHGVKIHGVTFNQALQCWLSESSNKTNSGKDASCKMRFTDSCPPM
SCQKDCPPIYDPTTGVEIEIPMSNVKDLDKKESRPDPDYMEFLNRVIKDI
NTG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

TFSKNSRMYFIQTISFCVIIRMCIANPIPIVTNGSSKQQTDCLAEMERVF
LMDEKITCNDGSKSGYYLRENQNSEDWIIYLEGGWFCHNEASCTTRMNHS
SLFSMTSSKLWHDCRKGDGMVHPDSNSNPLFYHYNHVYVPYCSSDFWLGN
TNQITSKGENIAFHGSKILIRLITELLNKRLAKASTLVLAGSSAGGIGVL
QNIDRVAKIVQTLKPNIEVKGIIDSAYFLEASLNSNCKSDGCNNSDLELK
LATSYWGALLDSTCDKGYRCLFAENMLLTVKTPIFMFQWLYDTVQIMADN
RALETHLDEIFQPENMAFVLKLGEKMRKLLKESDERIGLFAPSCIAHTAL
ASSSVFHGVKIHGVTFNQALQCWLSESSNKTNSGKDASCKMRFTDSCPPM
SCQKDCPPIYDPTTGVEIEIPMSNVKDLDKKESRPDPDYMEFLNRVIKDI
NTG


Reference
    Title: Punctuated emergences of genetic and phenotypic innovations in eumetazoan, bilaterian, euteleostome, and hominidae ancestors
    Wenger Y, Galliot B
    Ref: Genome Biol Evol, 5:1949, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer