Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mychy-LIP

Mycoplasma hyopneumoniae (and strain J / ATCC 25934 / NCTC 10110) (and strain 7448) triacylglycerol lipase

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Mycoplasma hyopneumoniae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Tenericutes: N E > Mollicutes: N E > Mycoplasmatales: N E > Mycoplasmataceae: N E > Mycoplasma: N E > Mycoplasma hyopneumoniae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: AY090779, AE017332, AE017243
3 UniProt : Q601S5, Q4AA85, Q4A8B2
>3 UniProt links 1 more: Q8RKV0, Q601S5, Q4AA85
>3 Interpro links 1 more: Q8RKV0, Q601S5, Q4AA85
>3 Pfam links 1 more: Q8RKV0, Q601S5, Q4AA85
>3 PIRSF links 1 more: Q8RKV0, Q601S5, Q4AA85
>3 SUPERFAM links 1 more: Q8RKV0, Q601S5, Q4AA85
Sequence
Graphical view for this peptide sequence: mychy-LIP
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MVVNRKIKIDNEEIFYFLEDNNRPKVLFLHGFNSSHNFTFQLRQNKKRKY
DIVAFDFPGCGKSSNNQKISVENYQKIAVNFIKTLDLKVKIVVAHSLGAA
IGLHILKENLVEKAILAGPLNPFIFDSSFKKQMERLGFWLLPRNLYEAKE
TVTNLFYKDKPNSEASLFKSAIAFFKLVEEKKELFSDMVFDQILNLDWHK
NVLLPLYEQKNEYFLIGAEMDKFVPLRSVEKVGATFGKKVVKFEKTGHAI
FYEKSDLINAEIEKIL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVVNRKIKIDNEEIFYFLEDNNRPKVLFLHGFNSSHNFTFQLRQNKKRKY
DIVAFDFPGCGKSSNNQKISVENYQKIAVNFIKTLDLKVKIVVAHSLGAA
IGLHILKENLVEKAILAGPLNPFIFDSSFKKQMERLGFWLLPRNLYEAKE
TVTNLFYKDKPNSEASLFKSAIAFFKLVEEKKELFSDMVFDQILNLDWHK
NVLLPLYEQKNEYFLIGAEMDKFVPLRSVEKVGATFGKKVVKFEKTGHAI
FYEKSDLINAEIEKIL


References
    Title: Swine and poultry pathogens: the complete genome sequences of two strains of Mycoplasma hyopneumoniae and a strain of Mycoplasma synoviae
    Vasconcelos AT, Ferreira HB, Bizarro CV, Bonatto SL, Carvalho MO, Pinto PM, Almeida DF, Almeida LG, Almeida R and Zaha A <76 more author(s)>
    Ref: Journal of Bacteriology, 187:5568, 2005 : PubMed

            

    Title: The genome sequence of Mycoplasma hyopneumoniae strain 232, the agent of swine mycoplasmosis
    Minion FC, Lefkowitz EJ, Madsen ML, Cleary BJ, Swartzell SM, Mahairas GG
    Ref: Journal of Bacteriology, 186:7123, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer