Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mycvn-q25ug5

Mycobacterium vanbaalenii PYR-1 alpha/beta hydrolase fold precursor

Comment
Other strains: Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1) (Mycobacterium vanbaalenii)


Relationship
Family|AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Mycobacterium vanbaalenii PYR-1
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium vanbaalenii: N E > Mycobacterium vanbaalenii PYR-1: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AAPF01000007, WP_011779713, ABM13301
1 UniProt : A1T801
1 Interpro : A1T801
1 Pfam : A1T801
1 PIRSF : A1T801
1 SUPERFAM : A1T801
Sequence
Graphical view for this peptide sequence: mycvn-q25ug5
Colored MSA for AlphaBeta_hydrolase (raw)
MRRLVPAVVLSMAVVLPLAACSPGLAANPRFATDSGAGPQGSPQTSDQPP
GPPGVEAPKNDLSWRDCTSRVFASAAVQPLGGVKLDCASYDADLDPINGA
TGTVSIGVVRATSVETPADAGPLVMTTGSDLPSSVQLPVWLSRAGSDVLK
SHPIVSVDRRGIGMSGALDCRDLFDRQEMFEQAQFQSGDDPVANLGAITM
TATTSCTDTIAPGDSAYDNSHAAEDIERLRTTWDVPTLALLGIGNGAQVA
LAYAGSHPNKVARLVLDSPLPLGISAEAATEQRVKGEQAALDAWAAQCVA
TNCPLGPDPKAAVDALLTAARQGNGPGGASVAAVADAISTALGYPRGGRV
DAGTELALAIADARSGDTNRLNNLINQAETLRQTDGQFVNTCSDALNRPT
PDRVRELVVAWGKMYPQFGTVGALDMVKCLNWPSGSAPKEPSELEIPTLL
LGVANNPIVGNEGVAAVAATAINAGSSNRRVMWQGIGHGATIYSSCALPP
VLEYLKSGELPSTDTYCPA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRRLVPAVVLSMAVVLPLAACSPGLAANPRFATDSGAGPQGSPQTSDQPP
GPPGVEAPKNDLSWRDCTSRVFASAAVQPLGGVKLDCASYDADLDPINGA
TGTVSIGVVRATSVETPADAGPLVMTTGSDLPSSVQLPVWLSRAGSDVLK
SHPIVSVDRRGIGMSGALDCRDLFDRQEMFEQAQFQSGDDPVANLGAITM
TATTSCTDTIAPGDSAYDNSHAAEDIERLRTTWDVPTLALLGIGNGAQVA
LAYAGSHPNKVARLVLDSPLPLGISAEAATEQRVKGEQAALDAWAAQCVA
TNCPLGPDPKAAVDALLTAARQGNGPGGASVAAVADAISTALGYPRGGRV
DAGTELALAIADARSGDTNRLNNLINQAETLRQTDGQFVNTCSDALNRPT
PDRVRELVVAWGKMYPQFGTVGALDMVKCLNWPSGSAPKEPSELEIPTLL
LGVANNPIVGNEGVAAVAATAINAGSSNRRVMWQGIGHGATIYSSCALPP
VLEYLKSGELPSTDTYCPA



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer