Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: orcci-a0a1d2n2u1

Orchesella cincta (Springtail). Alpha/beta hydrolase domain-containing protein 13

Relationship
Family|ABHD13-BEM46
Block| X
Position in NCBI Life Tree|Orchesella cincta
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Collembola [class]: N E > Collembola [order]: N E > Entomobryomorpha: N E > Entomobryoidea: N E > Entomobryidae: N E > Orchesellinae: N E > Orchesella: N E > Orchesella cincta: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : LJIJ01000269
1 UniProt : A0A1D2N2U1
1 UniProt : A0A1D2N2U1
1 Interpro : A0A1D2N2U1
1 Pfam : A0A1D2N2U1
1 PIRSF : A0A1D2N2U1
1 SUPERFAM : A0A1D2N2U1
Sequence
Graphical view for this peptide sequence: orcci-a0a1d2n2u1
Colored MSA for ABHD13-BEM46 (raw)
MRTYHITDYFLYQPDMPGDSRLFVESPARYTMHFEDVWIHTKDRVKIHGY
LIQQNRLSNRNVPTIIFFHGNAGNIGHRLENVKLFYYQLNCNVLMVEYRG
YGRSEGAPSEKGLYADAQAAFEYIDSREDLDSKKIILFGRSLGGAVAIDL
AARCDFRDRVAALIVENTFTSIPAIAKELFKFAILKWVPNFCYKNRFESL
QKIGSVACPTLFISGTNDELLPPSMTNELYSKCAAGVKLLHRFPGGHNDT
WICKDYIPKIAEFIEEEVVAGKRKSTTKYQAYSDNIV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRTYHITDYFLYQPDMPGDSRLFVESPARYTMHFEDVWIHTKDRVKIHGY
LIQQNRLSNRNVPTIIFFHGNAGNIGHRLENVKLFYYQLNCNVLMVEYRG
YGRSEGAPSEKGLYADAQAAFEYIDSREDLDSKKIILFGRSLGGAVAIDL
AARCDFRDRVAALIVENTFTSIPAIAKELFKFAILKWVPNFCYKNRFESL
QKIGSVACPTLFISGTNDELLPPSMTNELYSKCAAGVKLLHRFPGGHNDT
WICKDYIPKIAEFIEEEVVAGKRKSTTKYQAYSDNIV


Reference
    Title: Gene Family Evolution Reflects Adaptation to Soil Environmental Stressors in the Genome of the Collembolan Orchesella cincta
    Faddeeva-Vakhrusheva A, Derks MF, Anvar SY, Agamennone V, Suring W, Smit S, van Straalen NM, Roelofs D
    Ref: Genome Biol Evol, 8:2106, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer