Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: orysa-q69y17

Oryza sativa subsp. japonica (Rice) putative prmc3

Relationship
Family|Plant_carboxylesterase
Block| H
Position in NCBI Life Tree|Oryza sativa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > Liliopsida: N E > Petrosaviidae: N E > commelinids: N E > Poales: N E > Poaceae: N E > BOP clade: N E > Oryzoideae: N E > Oryzeae: N E > Oryzinae: N E > Oryza: N E > Oryza sativa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AP003525, AP003458
2 UniProt : Q69Y17, C7J394
2 UniProt : Q69Y17, C7J394
2 Interpro : Q69Y17, C7J394
2 Pfam : Q69Y17, C7J394
2 PIRSF : Q69Y17, C7J394
2 SUPERFAM : Q69Y17, C7J394
Sequence
Graphical view for this peptide sequence: orysa-q69y17
Colored MSA for Plant_carboxylesterase (raw)
MDPDSEVAFDFQPYLCQYKSGRVFRLGGDPTVPAGTDPVTRVVSRDIHAG
AARARVYLPPGAAVSTEKLPVVVYFHGGGFVTGSPARPSTHAYLNDLVAR
AGAIGVSVYYRLAPENPLPAAYEDAWAAVRWAATRGDGADPWLLDHADLS
RLFLAGCSAGANIAHNMAVRCGGGGALPDGVTLRGLVVVHPYFTGKEAVG
AEAAFGPDVREFFDRTWRFVFPETSGLDDPRVNPFVDDATRAAAAAIPCE
RVQVCVAEQDVLLKERGLWYHRELKASGYGGEVELFESKGVGHAFHFVGM
AGSDQAVELLERNVEFIKK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDPDSEVAFDFQPYLCQYKSGRVFRLGGDPTVPAGTDPVTRVVSRDIHAG
AARARVYLPPGAAVSTEKLPVVVYFHGGGFVTGSPARPSTHAYLNDLVAR
AGAIGVSVYYRLAPENPLPAAYEDAWAAVRWAATRGDGADPWLLDHADLS
RLFLAGCSAGANIAHNMAVRCGGGGALPDGVTLRGLVVVHPYFTGKEAVG
AEAAFGPDVREFFDRTWRFVFPETSGLDDPRVNPFVDDATRAAAAAIPCE
RVQVCVAEQDVLLKERGLWYHRELKASGYGGEVELFESKGVGHAFHFVGM
AGSDQAVELLERNVEFIKK


Reference
    Title: The map-based sequence of the rice genome.
    Matsumo T, Sasaki T
    Ref: Nature, 436:793, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer