Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: psemy-a4xv01

Pseudomonas mendocina Putative uncharacterized protein

Comment
Other strains: Pseudomonas mendocina (ymp; DLHK; EGD-AQ5)


Relationship
Family|Pectinacetylesterase-Notum
Block| X
Position in NCBI Life Tree|Pseudomonas mendocina
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas aeruginosa group: N E > Pseudomonas mendocina: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : CP000680, ALKM01000003, AVQF01000012
1 UniProt : A4XV01
1 UniProt : A4XV01
1 Interpro : A4XV01
1 Prodom : A4XV01
1 Pfam : A4XV01
1 PIRSF : A4XV01
1 SUPERFAM : A4XV01
Sequence
Graphical view for this peptide sequence: psemy-a4xv01
Colored MSA for Pectinacetylesterase-Notum (raw)
MPVVTPWSLHRAVPAVLLLALSAPASAELGDYNFWQTLSNLVSPPKADNP
VTPAQRTGPYPLLANPAGFNSGFNPGNYYGWQTIQMAPQTGAVCGNGSPY
KFFINRVPNTRNTIIYLEGGGACWDYASCSGQSGIRGARNPNGIADDYMS
LLNPGASLVSPFVVRLHPWTRVKTQNWNMVYVPYCTGDIYSGDKVAVYED
PQGQQPPLVWHHNGLRNMRAVVGWLKDNLPRPTQMLATGCSAGGAGSLTN
YANLRQDIAPNRGYLINDSGPVYTALAGDNQAYPSYPLQTLIRQAWGLDA
AQGPLQYLQARLPGFSSTDLGSLYPALSSNLPGDRMGHTHFWQDLNYSSY
SYERFYPEIVNAPDQATKEVLIKQRWSTDTSRLRGQLANLGNVGGYFPQF
RNVNESHCTSIIEFANSDIQEQNLELDHFVSNVLDGTGQVLDASESSDVA
DRNKPFNLLYYLLDQLL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPVVTPWSLHRAVPAVLLLALSAPASAELGDYNFWQTLSNLVSPPKADNP
VTPAQRTGPYPLLANPAGFNSGFNPGNYYGWQTIQMAPQTGAVCGNGSPY
KFFINRVPNTRNTIIYLEGGGACWDYASCSGQSGIRGARNPNGIADDYMS
LLNPGASLVSPFVVRLHPWTRVKTQNWNMVYVPYCTGDIYSGDKVAVYED
PQGQQPPLVWHHNGLRNMRAVVGWLKDNLPRPTQMLATGCSAGGAGSLTN
YANLRQDIAPNRGYLINDSGPVYTALAGDNQAYPSYPLQTLIRQAWGLDA
AQGPLQYLQARLPGFSSTDLGSLYPALSSNLPGDRMGHTHFWQDLNYSSY
SYERFYPEIVNAPDQATKEVLIKQRWSTDTSRLRGQLANLGNVGGYFPQF
RNVNESHCTSIIEFANSDIQEQNLELDHFVSNVLDGTGQVLDASESSDVA
DRNKPFNLLYYLLDQLL


Reference
    Title: Genome sequence of Pseudomonas mendocina DLHK, isolated from a biotrickling reactor
    Wong CF, Niu H, Jiang J, Li J, Chan CM, Leung DY, Leung FC
    Ref: Journal of Bacteriology, 194:6326, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer