Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: psesp-OPH

Pseudomonas sp. pvaB. oxidized polyvinyl alcohol hydrolase precursor

Relationship
Family|AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Pseudomonas sp.
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas sp.: N E


Molecular evidence
Database
No mutation
7 structures (e.g. : 3WL5, 3WL6, 3WL7... more)
No kinetic





2 substrates: Paranitrophenyl-octanoate, Paranitrophenylbutyrate
4 inhibitors (e.g. : Acetylacetone, DMSO, Diethylene-glycol-monoethyl-ether... more)
1 Genbank : AB008494
>3 Structure links 4 more: 3WWC, 3WWD, 3WWE
1 UniProt : Q9LCQ7
1 Interpro : Q9LCQ7
1 Prodom : Q9LCQ7
1 Pfam : Q9LCQ7
1 PIRSF : Q9LCQ7
1 SUPERFAM : Q9LCQ7
Sequence
Graphical view for this peptide sequence: psesp-OPH
Colored MSA for AlphaBeta_hydrolase (raw)
MNQSLGVLRLTRGVIALALASVASGCSSTGADRTAATPAAANPAATEPVK
WECPAGYEVKEGLNVDFPHKGMKRAFIVYPAKNVSGPAPVWVPMTGSVES
TNDNLTVARSGANSILADHGYTVIAPVRACANQDPNIRGERCNGPGSNGW
NWNPWFEGRAADPSGEHWKNDEGPDSSFFVAMVQCVGTKYKLDARRLFLG
GISSGGTMTNRALLFRSNFWAGGLPISGEWYVTSDDGTPLSFDDARAAVA
AAPTKIHQGRVGPYPLPAKVGPLIVMTVWGGEKDLWNCTRPDGSRFLCAD
YRPSTQAGSNFFSAQPDVVHVACSSTHGHMWPQLNTQEFNRWALDTLASH
PKGSDPRSFKLTQPPEGYTCHVGPFTGLY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNQSLGVLRLTRGVIALALASVASGCSSTGADRTAATPAAANPAATEPVK
WECPAGYEVKEGLNVDFPHKGMKRAFIVYPAKNVSGPAPVWVPMTGSVES
TNDNLTVARSGANSILADHGYTVIAPVRACANQDPNIRGERCNGPGSNGW
NWNPWFEGRAADPSGEHWKNDEGPDSSFFVAMVQCVGTKYKLDARRLFLG
GISSGGTMTNRALLFRSNFWAGGLPISGEWYVTSDDGTPLSFDDARAAVA
AAPTKIHQGRVGPYPLPAKVGPLIVMTVWGGEKDLWNCTRPDGSRFLCAD
YRPSTQAGSNFFSAQPDVVHVACSSTHGHMWPQLNTQEFNRWALDTLASH
PKGSDPRSFKLTQPPEGYTCHVGPFTGLY


References
    Title: Structural insights into enzymatic degradation of oxidized polyvinyl alcohol
    Yang Y, Ko TP, Liu L, Li J, Huang CH, Chan HC, Ren F, Jia D, Wang AH and Du G <2 more author(s)>
    Ref: Chembiochem, 15:1882, 2014 : PubMed

            

    Title: The gene pvaB encodes oxidized polyvinyl alcohol hydrolase of Pseudomonas sp. strain VM15C and forms an operon with the polyvinyl alcohol dehydrogenase gene pvaA
    Shimao M, Tamogami T, Kishida S, Harayama S
    Ref: Microbiology, 146 ( Pt 3):649, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer