Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: psesx-a0a0p9id10

Pseudomonas syringae; Pseudomonas congelans; Pseudomonas sp.; Pseudomonas cerasi; Pseudomonas avellanae. Type IV secretion system component VirJ-like protein

Comment
Other strains: Pseudomonas syringae (pv. atrofaciens; pv. syringae (HS191; SM); pv. aceris; pv. castaneae; pv. solidagae; pv. coryli; pv. eriobotryae; pv. lapsa; pv. papulans; pv. aptata; pv. japonica (M301072; M301072); pv. pisi str. 1704B; pv. avellanae str. ISPaVe037; Cit 7); Pseudomonas congelans; Pseudomonas sp.; Pseudomonas cerasi; Pseudomonas avellanae BPIC 631


Relationship
Family|VirJ
Block| X
Position in NCBI Life Tree|Pseudomonas syringae pv. atrofaciens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas syringae group: N E > Pseudomonas syringae group genomosp. 1: N E > Pseudomonas syringae: N E > Pseudomonas syringae pv. atrofaciens: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: psesx-a0a0p9id10
Colored MSA for VirJ (raw)
MGETLMIRRSWRLLLAALVIVLLIVALGVWVWTRPAPPASLEHSNLDGGA
PLTSVTPATSIKTRIALAVTTEDMLSDKQLLAISKDASARIIQVVLPKDD
CVLQQKTFQDALTKLDGPAKVVGGIGPGATLAWRWLAGQTDDKAQAISVD
FALEHASNPPPVLEEDEKPPQICDVPLPQKAAHGHWLAAWNDAPDDPSAA
FVRDQTNADTSISDYDIPLPQVLNTELRHLLLGENDSGGLGIPTVEVPAS
QPSDTVTLFMSGDGGWRDLDKVVAGDMAKMGYPVVGIDVLRYYWEHKTPE
QTAVDLTDLMNHYRQKWGTKRFILAGYSFGADVMPAIYNRLAADDQNRVD
AIILLAFARTGSFEIHVDGWLGNAGKEATTGQEMAKLPAAKVFCVYGVEE
KKDSGCTDTTAVGEAVQLPGGHHFDEDYPALAKRLIDAINKRQGKTAAQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGETLMIRRSWRLLLAALVIVLLIVALGVWVWTRPAPPASLEHSNLDGGA
PLTSVTPATSIKTRIALAVTTEDMLSDKQLLAISKDASARIIQVVLPKDD
CVLQQKTFQDALTKLDGPAKVVGGIGPGATLAWRWLAGQTDDKAQAISVD
FALEHASNPPPVLEEDEKPPQICDVPLPQKAAHGHWLAAWNDAPDDPSAA
FVRDQTNADTSISDYDIPLPQVLNTELRHLLLGENDSGGLGIPTVEVPAS
QPSDTVTLFMSGDGGWRDLDKVVAGDMAKMGYPVVGIDVLRYYWEHKTPE
QTAVDLTDLMNHYRQKWGTKRFILAGYSFGADVMPAIYNRLAADDQNRVD
AIILLAFARTGSFEIHVDGWLGNAGKEATTGQEMAKLPAAKVFCVYGVEE
KKDSGCTDTTAVGEAVQLPGGHHFDEDYPALAKRLIDAINKRQGKTAAQ



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer