Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: puct1-j3pwy2

Puccinia triticina (isolate 1-1 / race 1 (BBBD)) (Brown leaf rus fungus) Uncharacterized protein

Relationship
Family|Carb_B_Root
Block| C
Position in NCBI Life Tree|Puccinia triticina
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Basidiomycota: N E > Pucciniomycotina: N E > Pucciniomycetes: N E > Pucciniales: N E > Pucciniaceae: N E > Puccinia: N E > Puccinia triticina: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 UniProt : A0A0C4ES74, A0A180GTK3
2 Interpro : A0A0C4ES74, A0A180GTK3
2 Pfam : A0A0C4ES74, A0A180GTK3
2 PIRSF : A0A0C4ES74, A0A180GTK3
2 SUPERFAM : A0A0C4ES74, A0A180GTK3
Sequence
Graphical view for this peptide sequence: puct1-j3pwy2
Colored MSA for Carb_B_Root (raw)
MSGNPSLLKVETAYGPVIGFEDSGHPNGKSAVDQSSPRFPVKKFLGVPYA
QAERWKRAQPPPPWKEPLVCQEFGPSIPQIHVAPFDQFYNPPLLARRGTS
NSEEKGLSVNIFCSSDVKEGDKVPVLLVVCVVSGGGLLNGASCVTTYDPT
EWIRREAAKGHKFIVISGNYRTNLLGFLASSDLAEEDPEGLAGNYGGYDC
ISYLKWVQNNIARFGGDPDNVTAFGESAGALLLSHLMICKEKLFRRVILQ
SGAVHTLPTVSWETHENNYQQLLKKASIKADSGSERLKALRNLPIEDLVT
YLSGSIREVGFALENTSSPNAVWNHPCVLSRLKEGHWSPHIESVMMGVCK
DEGALLAHMAQSHTPPGYAFVQMEMLNGVTADKLAPLYHSPVQAEIDSPP
EGSPLDLTQCSGSQPIGDRLFKVPMELMLCTLDETKNFETQNPLSIYVYT
LEGTAKETNVPGRFFGTPHTIDLVLLFNMSNCWAADSESAKVSATLGKTW
YNFAKDGCPGLNWPQYQSQHSPYKLIFQQDGECGIQDVRERPEIEKERIK
FWAEALDLADFWEPPVIGILDGASSTDSSEMHRNKSNQSI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSGNPSLLKVETAYGPVIGFEDSGHPNGKSAVDQSSPRFPVKKFLGVPYA
QAERWKRAQPPPPWKEPLVCQEFGPSIPQIHVAPFDQFYNPPLLARRGTS
NSEEKGLSVNIFCSSDVKEGDKVPVLLVVCVVSGGGLLNGASCVTTYDPT
EWIRREAAKGHKFIVISGNYRTNLLGFLASSDLAEEDPEGLAGNYGGYDC
ISYLKWVQNNIARFGGDPDNVTAFGESAGALLLSHLMICKEKLFRRVILQ
SGAVHTLPTVSWETHENNYQQLLKKASIKADSGSERLKALRNLPIEDLVT
YLSGSIREVGFALENTSSPNAVWNHPCVLSRLKEGHWSPHIESVMMGVCK
DEGALLAHMAQSHTPPGYAFVQMEMLNGVTADKLAPLYHSPVQAEIDSPP
EGSPLDLTQCSGSQPIGDRLFKVPMELMLCTLDETKNFETQNPLSIYVYT
LEGTAKETNVPGRFFGTPHTIDLVLLFNMSNCWAADSESAKVSATLGKTW
YNFAKDGCPGLNWPQYQSQHSPYKLIFQQDGECGIQDVRERPEIEKERIK
FWAEALDLADFWEPPVIGILDGASSTDSSEMHRNKSNQSI



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer