Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: solde-q6l459

Solanum demissum (Wild potato) hypothetical protein pgec589.7

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Solanum demissum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > asterids: N E > lamiids: N E > Solanales: N E > Solanaceae: N E > Solanoideae: N E > Solaneae: N E > Solanum: N E > Solanum demissum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AC142210
1 UniProt : Q6L459
1 UniProt : Q6L459
1 Interpro : Q6L459
1 Pfam : Q6L459
1 PIRSF : Q6L459
1 SUPERFAM : Q6L459
Sequence
Graphical view for this peptide sequence: solde-q6l459
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MSEVNESSSSWREGTGSVVGDTEIRYNSRYSAVGGGYGGGPAGVEVKGKD
GENWKFHAVEFAKGFVEMSVEFGKGVRDVLKQSVIREDSILVRKVGPLCC
KVCRRLSFLNEYLPEDRDPAHAWSVIFFVLFLASAVLIASNDNIYPTTSV
KKVCIHPPSASRISLPDGRHLAYQQQGVPAELARFSMIAPHSFVSSRLAG
IPGIKTSLLQEYGIRLVTYDLPGFGESDPHPSRNLESSAMDMLHLSYAVN
VTDKFWVVGFSDGCMHAWAALRYIPDRIAGAVMVAPMVSPYEPRMTKEEK
SKMWKKWTTKKKNMYILARKFPRLLPYLYRRSFLSGVHGQIETRLALSLG
IRDKALLEHPLFEKFWQRDVEESVRQKNAKPFLEEAVLQVSNWGFSPADL
KVQRKRPGKGIMHWIKSLFGQTEEILTGFLGQIHVWQGMEDMVVPPSTSD
FLQRVLPDAMVHRLLYEGHFTYFYFCDECHRHIFSTVFGNPQGPLTPAPE
PEPEPEPDQSPIQNDDGETQDTILGDVATDEENVSSVVNPDKEDYID
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSEVNESSSSWREGTGSVVGDTEIRYNSRYSAVGGGYGGGPAGVEVKGKD
GENWKFHAVEFAKGFVEMSVEFGKGVRDVLKQSVIREDSILVRKVGPLCC
KVCRRLSFLNEYLPEDRDPAHAWSVIFFVLFLASAVLIASNDNIYPTTSV
KKVCIHPPSASRISLPDGRHLAYQQQGVPAELARFSMIAPHSFVSSRLAG
IPGIKTSLLQEYGIRLVTYDLPGFGESDPHPSRNLESSAMDMLHLSYAVN
VTDKFWVVGFSDGCMHAWAALRYIPDRIAGAVMVAPMVSPYEPRMTKEEK
SKMWKKWTTKKKNMYILARKFPRLLPYLYRRSFLSGVHGQIETRLALSLG
IRDKALLEHPLFEKFWQRDVEESVRQKNAKPFLEEAVLQVSNWGFSPADL
KVQRKRPGKGIMHWIKSLFGQTEEILTGFLGQIHVWQGMEDMVVPPSTSD
FLQRVLPDAMVHRLLYEGHFTYFYFCDECHRHIFSTVFGNPQGPLTPAPE
PEPEPEPDQSPIQNDDGETQDTILGDVATDEENVSSVVNPDKEDYID



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer