Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: sollc-a0a3q7f7t8

Solanum lycopersicum (Tomato) (Lycopersicon esculentum). AB hydrolase-1 domain-containing protein

Relationship
Family|Auxin-response-4
Block| X
Position in NCBI Life Tree|Solanum lycopersicum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > asterids: N E > lamiids: N E > Solanales: N E > Solanaceae: N E > Solanoideae: N E > Solaneae: N E > Solanum: N E > Lycopersicon: N E > Solanum lycopersicum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : XP_004230203
1 UniProt : A0A3Q7F7T8
1 UniProt : A0A3Q7F7T8
1 Interpro : A0A3Q7F7T8
1 Pfam : A0A3Q7F7T8
1 PIRSF : A0A3Q7F7T8
1 SUPERFAM : A0A3Q7F7T8
Sequence
Graphical view for this peptide sequence: sollc-a0a3q7f7t8
Colored MSA for Auxin-response-4 (raw)
MAIITEEPDSPSPLKQRKTLKPTSKPSQSTAPEPIKPTKTTNATNPFHFW
FYFTISVSLVTLIFMILTSLYTQDPKTWFLSLPLNLRQHYAKGRNIKVQT
APNQPQIEVFAIQEGPSKSSDQVLIVHGLGCSSFAFQKVVNFLGVRGVHA
VAIDLPGSGFSDKTMVVEEEHVDDGVLRRLKDMYNEIQEKGIFWGFDQLV
EQGYVNYEENKIRVSKRNVVKAVDLGPEEIGKVLGQVIDTMGLSPVDLVL
HDSALGLTANWVSENRGLLRSVVVLDSAPTGTALPLWVLEMPVLRDAVLG
LGFAFRRLLGTCCSRSVGNLEAEGHRILLKGRDGRRAVVGMGKSLNCSFD
LNEWAALDGVKGLPMQVIWSDALSKEWTEEGRQVADAIPQAKFISHSGGR
WPQEHNSEEIAESIYQFVSSLPKNVKQTEETVPEHVQTMSDEAKSGDHHH
HHGHDSHGHEHAHAGYMDAYGLGQEWAM
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAIITEEPDSPSPLKQRKTLKPTSKPSQSTAPEPIKPTKTTNATNPFHFW
FYFTISVSLVTLIFMILTSLYTQDPKTWFLSLPLNLRQHYAKGRNIKVQT
APNQPQIEVFAIQEGPSKSSDQVLIVHGLGCSSFAFQKVVNFLGVRGVHA
VAIDLPGSGFSDKTMVVEEEHVDDGVLRRLKDMYNEIQEKGIFWGFDQLV
EQGYVNYEENKIRVSKRNVVKAVDLGPEEIGKVLGQVIDTMGLSPVDLVL
HDSALGLTANWVSENRGLLRSVVVLDSAPTGTALPLWVLEMPVLRDAVLG
LGFAFRRLLGTCCSRSVGNLEAEGHRILLKGRDGRRAVVGMGKSLNCSFD
LNEWAALDGVKGLPMQVIWSDALSKEWTEEGRQVADAIPQAKFISHSGGR
WPQEHNSEEIAESIYQFVSSLPKNVKQTEETVPEHVQTMSDEAKSGDHHH
HHGHDSHGHEHAHAGYMDAYGLGQEWAM


Reference
    Title: The tomato genome sequence provides insights into fleshy fruit evolution
    Sato S, Tomato Genome Consortium
    Ref: Nature, 485:635, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer