Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: sphwj-c0la90

Sphingobium faniae; Sphingobium wenxiniae, Pyrethroid hydrolase pytH

Comment
Other strains: Sphingobium wenxiniae (strain DSM 21828 / JZ-1), Sphingobium faniae


Relationship
Family|HNLyase_Bact
Block| X
Position in NCBI Life Tree|Sphingobium faniae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Sphingomonadales: N E > Sphingomonadaceae: N E > Sphingobium: N E > Sphingobium faniae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
4 structures (e.g. : 5Y51, 5Y57, 5Y5R... more)
No kinetic





1 substrate:
trans-Bifenthrin
No inhibitor
2 Genbank : GU119902, FJ688006
2 UniProt : D0VUS3, C0LA90
>3 Structure links 1 more: 5Y5R, 5Y5V, 5Y57
2 UniProt : D0VUS3, C0LA90
2 Interpro : D0VUS3, C0LA90
2 Prodom : D0VUS3, C0LA90
2 Pfam : D0VUS3, C0LA90
2 PIRSF : D0VUS3, C0LA90
2 SUPERFAM : D0VUS3, C0LA90
Sequence
Graphical view for this peptide sequence: sphwj-c0la90
Colored MSA for HNLyase_Bact (raw)
MTVTDIILIHGALNRGACYDAVVPLLEARGYRVHAPDLTGHTPGDGGHLS
VVDMEHYTRPVADILARAEGQSILLGHSLGGASISWLAQHHPDKVAGLIY
LTAVLTAPGITPETFVLPGEPNRGTPHALDLIQPVDEGRGLQADFSRLER
LREVFMGDYPGEGMPPAEQFIQTQSTVPFGTPNPMEGRALEIPRLYIEAL
DDVVIPIAVQRQMQKEFPGPVAVVSLPASHAPYYSMPERLAEAIADFADA
PAEYRQTATKAGPDRPAGADGGRADRADLP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTVTDIILIHGALNRGACYDAVVPLLEARGYRVHAPDLTGHTPGDGGHLS
VVDMEHYTRPVADILARAEGQSILLGHSLGGASISWLAQHHPDKVAGLIY
LTAVLTAPGITPETFVLPGEPNRGTPHALDLIQPVDEGRGLQADFSRLER
LREVFMGDYPGEGMPPAEQFIQTQSTVPFGTPNPMEGRALEIPRLYIEAL
DDVVIPIAVQRQMQKEFPGPVAVVSLPASHAPYYSMPERLAEAIADFADA
PAEYRQTATKAGPDRPAGADGGRADRADLP


References
    Title: Structure and Catalytic Mechanism of a Pyrethroid Carboxylesterase PytH from Sphingobium faniae JZ-2
    Xu D, Gao Y, Sun B, Ran T, Zeng L, He J, Wang W
    Ref: Applied Environmental Microbiology, :, 2020 : PubMed

            

    Title: Cloning of a novel pyrethroid-hydrolyzing carboxylesterase gene from Sphingobium sp. strain JZ-1 and characterization of the gene product
    Wang BZ, Guo P, Hang BJ, Li L, He J, Li SP
    Ref: Applied Environmental Microbiology, 75:5496, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer