Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: talsn-faeb

Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) (Penicillium stipitatum). Ferulic acid esterase B

Relationship
Family|Esterase_phb
Block| X
Position in NCBI Life Tree|Talaromyces stipitatus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Trichocomaceae: N E > Talaromyces: N E > Talaromyces stipitatus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : EQ962655, XP_002481731
1 UniProt : B8M9H9
1 UniProt : B8M9H9
1 Interpro : B8M9H9
1 Pfam : B8M9H9
1 PIRSF : B8M9H9
1 SUPERFAM : B8M9H9
Sequence
Graphical view for this peptide sequence: talsn-faeb
Colored MSA for Esterase_phb (raw)
MAIPLVLLLAWLLPTVFAASLTQVSNFGDNPGSLQMYIYVPNNLASKPAI
IVAMHPCGGSATQYYGMYDYHTPADQYGYILIYPSATRDLNCFDADTAAS
LTHNGGSDSLSIVNMVKYTISKYGADSSKVYMTGSSSGAIMTNVLAGTYP
DVFAAGAAFSGMPFACLSGAGGADPAMSNQTCSRGQINHTPQEWAAYVHN
AYPGYTGQYPRLQVWHGTADNVISYTDFNQEISQWTTVMGLSFTSNQTNT
PLSGYTKMIYGDGSRFQAFSASGVGHFVPTDVSVVLDWFGITGGGGGNGG
GSGSTTTTTSATTTSTGPTGGCTAAHWDQCGGNGYTGCTSCASPYTCQKV
NDYYSQCL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAIPLVLLLAWLLPTVFAASLTQVSNFGDNPGSLQMYIYVPNNLASKPAI
IVAMHPCGGSATQYYGMYDYHTPADQYGYILIYPSATRDLNCFDADTAAS
LTHNGGSDSLSIVNMVKYTISKYGADSSKVYMTGSSSGAIMTNVLAGTYP
DVFAAGAAFSGMPFACLSGAGGADPAMSNQTCSRGQINHTPQEWAAYVHN
AYPGYTGQYPRLQVWHGTADNVISYTDFNQEISQWTTVMGLSFTSNQTNT
PLSGYTKMIYGDGSRFQAFSASGVGHFVPTDVSVVLDWFGITGGGGGNGG
GSGSTTTTTSATTTSTGPTGGCTAAHWDQCGGNGYTGCTSCASPYTCQKV
NDYYSQCL


References
    Title: Genome Sequence of the AIDS-Associated Pathogen Penicillium marneffei (ATCC18224) and Its Near Taxonomic Relative Talaromyces stipitatus (ATCC10500)
    Nierman WC, Fedorova-Abrams ND, Andrianopoulos A
    Ref: Genome Announc, 3:, 2015 : PubMed

            

    Title: The feruloyl esterase system of Talaromyces stipitatus: production of three discrete feruloyl esterases, including a novel enzyme, TsFaeC, with a broad substrate specificity
    Garcia-Conesa MT, Crepin VF, Goldson AJ, Williamson G, Cummings NJ, Connerton IF, Faulds CB, Kroon PA
    Ref: J Biotechnol, 108:227, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer