Gene_locus Report for: trier-q3h6u2Trichodesmium erythraeum IMS101 hypothetical protein Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Cyanobacteria/Melainabacteria group: N E > Cyanobacteria: N E > Oscillatoriophycideae: N E > Oscillatoriales: N E > Microcoleaceae: N E > Trichodesmium: N E > Trichodesmium erythraeum: N E > Trichodesmium erythraeum IMS101: N E
AlphaBeta_hydrolase : trier-q3h7z2Trichodesmium erythraeum IMS101 alpha/beta hydrolase fold, trier-q3h852Trichodesmium erythraeum IMS101 alpha/beta hydrolase fold, trier-q3hal6Trichodesmium erythraeum IMS101 alpha/beta hydrolase fold, trier-q3hh30Trichodesmium erythraeum IMS101 alpha/beta hydrolase fold, trier-q3hh38Trichodesmium erythraeum IMS101 AlphaBeta_hydrolase superfamily, trier-q3hia3Trichodesmium erythraeum IMS101 alpha/beta hydrolase fold, trier-q3hiz8Trichodesmium erythraeum IMS101 alpha/beta hydrolase fold. CIB-CCG1-interacting-factor-B : trier-q3hba1Trichodesmium erythraeum IMS101 hypothetical protein. Cocaine_esterase : trier-q3hes5Trichodesmium erythraeum IMS101 peptidase s15. Dienelactone_hydrolase : trier-q3hew1Trichodesmium erythraeum IMS101 carboxymethylenebutenolidase (EC 3.1.1.45), trier-q3hfx4Trichodesmium erythraeum IMS101 carboxymethylenebutenolidase (EC 3.1.1.45). Epoxide_hydrolase : triei-q111d9Trichodesmium erythraeum IMS101 alpha/beta hydrolase fold. Lipase_3 : trier-q114w8Trichodesmium erythraeum IMS101 lipase, class 3. LYsophospholipase_carboxylesterase : trier-q3hga7Trichodesmium erythraeum IMS101 phospholipase/carboxylesterase. PMH_Peptidase_S9 : triei-q115z2Trichodesmium erythraeum (strain IMS101) peptidase s9, prolyl oligopeptidase active site region. Prolyl_oligopeptidase_S9 : trier-q3hhs1Trichodesmium erythraeum IMS101 peptidase s9, prolyl oligopeptidase active site region. S9N_PPCE_Peptidase_S9 : trier-q3hef0Trichodesmium erythraeum IMS101 prolyl oligopeptidase (EC 3.4.21.26). Thioesterase : triei-q10y08Trichodesmium erythraeum (strain IMS101) region:phosphopantetheine-binding, trier-q3h9h6Trichodesmium erythraeum IMS101 thioesterase, trier-q3h843Trichodesmium erythraeum IMS101 amino acid adenylation, trier-q3hhx5Trichodesmium erythraeum IMS101 AMP-dependent synthetase and ligase:Thioesterase:Phosphopantetheine-binding
Molecular evidence | | Database | No mutation No structure No kinetic
No Substrate No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: trier-q3h6u2 Colored MSA for AlphaBeta_hydrolase (raw)
MLDCVAAEAVFAGGPFHGAGAWPLPIAGMSPQRVSGLALLDTGMDPIAPG
EAGESERAKRMALLQIARHSGMREMGLQWARGMVHPDRLDTPLFGEVLDM
VARFTPEVFAAQINALLNRPDAGDVLRQLRCPTLLACGRQDAWSPLSRHE
RMQALCPGAELVVIEDSGHMSTMEQPQQVSRALLDWMGR
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MLDCVAAEAVFAGGPFHGAGAWPLPIAGMSPQRVSGLALLDTGMDPIAPG EAGESERAKRMALLQIARHSGMREMGLQWARGMVHPDRLDTPLFGEVLDM VARFTPEVFAAQINALLNRPDAGDVLRQLRCPTLLACGRQDAWSPLSRHE RMQALCPGAELVVIEDSGHMSTMEQPQQVSRALLDWMGR
|
|
|