8CRU

Name : The crystal structure of GrAnc8, an evolved variant of IsPETase Ideonella sakaiensis Reconstruction 008

Revelation date : 21-Sep-2022

Family : Polyesterase-lipase-cutinase

Gene_locus : idesa-peth

PDB file : ESTHER: header of PDB entry RCSB: Full entry

Comment
Vongsouthi, V., Jackson, C.J., Tan, L.
> GrAnc8
NPYQRGPDPTTSSLEASRGPFSVASFTVSRPSGYGAGTVYYPTNAGGKVGAIAIVPGYTARQSSINWWGPRLASHGF
VVITIDTNSTLDQPSSRSSQQMAALRQVVSLSGTSSSPIYNKVDTSRLGVMGWSMGGGGSLISARNNPSLKAAAP
QAPWNSSKNFSSVTVPTLIIACENDTIAPVNSHALPFYNSMSRNPKQYLEINGGSHSCANSGNSNQALIGKKGVA
WMKRFMDNDTRYSSFACSNPNSSSVSDFRTENCS

Ligand :

References (1)

Title : Ancestral Sequence Reconstruction Identifies Structural Changes Underlying the Evolution of Ideonella sakaiensis PETase and Variants with Improved Stability and Activity - Joho_2022_Biochemistry__
Author(s) : Joho Y , Vongsouthi V , Spence MA , Ton J , Gomez C , Tan LL , Kaczmarski JA , Caputo AT , Royan S , Jackson CJ , Ardevol A
Ref : Biochemistry , : , 2022
PubMedID: 35951410
Gene_locus related to this paper: idesa-peth

Representative scheme of Prolylcarboxypeptidase structure and an image from PDBsum server

Databases

PDB-Sum : 8CRU Previously Class, Architecture, Topology and Homologous superfamily - PDB-Sum server

FSSP : 8CRU Fold classification based on Structure-Structure alignment of Proteins - FSSP server

SCOP : 8CRU Structural Classification Of Protein - SCOP server

PROTEOPEDIA : 8CRU 3D, interactive encyclopedia of proteins - PROTEOPEDIA server