Name : The crystal structure of GrAnc8, an evolved variant of IsPETase Ideonella sakaiensis Reconstruction 008
Revelation date : 21-Sep-2022
Family : Polyesterase-lipase-cutinase
Gene_locus : idesa-peth
PDB file : ESTHER: header of PDB entry RCSB: Full entry
Comment
Vongsouthi, V., Jackson, C.J., Tan, L.
> GrAnc8
NPYQRGPDPTTSSLEASRGPFSVASFTVSRPSGYGAGTVYYPTNAGGKVGAIAIVPGYTARQSSINWWGPRLASHGF
VVITIDTNSTLDQPSSRSSQQMAALRQVVSLSGTSSSPIYNKVDTSRLGVMGWSMGGGGSLISARNNPSLKAAAP
QAPWNSSKNFSSVTVPTLIIACENDTIAPVNSHALPFYNSMSRNPKQYLEINGGSHSCANSGNSNQALIGKKGVA
WMKRFMDNDTRYSSFACSNPNSSSVSDFRTENCS
Ligand :
Title : Ancestral Sequence Reconstruction Identifies Structural Changes Underlying the Evolution of Ideonella sakaiensis PETase and Variants with Improved Stability and Activity - Joho_2022_Biochemistry__ |
Author(s) : Joho Y , Vongsouthi V , Spence MA , Ton J , Gomez C , Tan LL , Kaczmarski JA , Caputo AT , Royan S , Jackson CJ , Ardevol A |
Ref : Biochemistry , : , 2022 |
PubMedID: 35951410 |
Gene_locus related to this paper: idesa-peth |
PDB-Sum : 8CRU Previously Class, Architecture, Topology and Homologous superfamily - PDB-Sum server
FSSP : 8CRU Fold classification based on Structure-Structure alignment of Proteins - FSSP server
SCOP : 8CRU Structural Classification Of Protein - SCOP server
PROTEOPEDIA : 8CRU 3D, interactive encyclopedia of proteins - PROTEOPEDIA server