Family

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Family Report for: Steryl_acetyl_hydrolase

Steryl_acetyl_hydrolase


Genes:Proteins in Steryl_acetyl_hydrolase (64)
I.Order by Gene_locus or oder by Structures or order by number of Papers SpeciesSequence
9viru-a4l1y2: Gryllus bimaculatus nudivirus Putative uncharacterized protein, 1 reference(s)Gryllus bimaculatus nudivirus Show
MYWTLFKILFSVIVILIFIIFISYPAPIKNMISKMHIAPIYNLNTQYGKE
YEKDGYTLYSSNKTVSNLLVWFHGGAFLYSDRKTAYGFLNNLFEYIKDDC
DILVFDYPVRFSNTVRDSMLRCNSIIKKFIFKYKSFYCGGMSAGCLLMGT
FIKKETVRGVAEKIQVPVIGVIFKAMIGLCGVYETNFNDSKLLNVAFDFY
IMSGTPYPKLYTCYGINLDKLIIGAISEYLYQQTYKYANTEPCNKIIYQN
KNLTHSFPLLLNTSESKECIKKIAEFLNDKFKFYD
artoc-c5fwe0: Arthroderma otae (strain CBS 113480) (Microsporum canis) Alpha/beta hydrolase fold proteinArthroderma otae Show
MATGKALTPVNSLVKLTLAEKLDFLPAGLGLLATAIAAAITGLVRGRDGA
RTYRTHIRHAVVRRFLWRMSIRQLRFMYPSTAQAYELYARGRGIKPQTVQ
LEHGAQGHWLGEKDAKNVVIYYHGGGFALPAYPAYFQLYSALLKQLNAAG
KDVAFFFLSYTLSPEGVYPTQLRQAVGALRYIVEETRRDPQNVFLGGDSA
GGNLTLGVLSHLSHPHKDIQPLKISAPLGGAFTMAPWVSMADKVPSYTRN
AKRDYLSLECGRSWAQAFIGNAEPDNYNHAIQAPPEWWKDIKTKSLLVYV
GSDDVIVDSVTQFVEKIKPVVPFTQYMICEGEPHIGPIINRRFGNREETK
MGKTLRLWFMENL
ashgo-q75a71: Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRY-1056) (Yeast) (Eremothecium gossypii) ADR047Wp, 1 reference(s)Ashbya gossypii Show
MGSPNKTWSVLAFLLKFYGLGVPAALARLVYSVVRRAGRRTLLGLLGVEA
ARHADPAAAAALRASVGTCVPWWHARRSFERGGEVLEETYVVQDSDLFEL
GGPAAAAAERTARAVYVSRPDKRHPDDPVVLYVHGGAFCEGLTPVDYALA
AKITAAYQCTFPQAAMLALDYAGAEDGGFPLAALDVVQLYRAVCREFPRG
PIWLVGSEAGGHLMLGLLQYLACADEEGLRWPRRAFCMTPWLNLTAWSAD
DAEYAAADADRSAVHGFLQRMAAAYCESLGEGAQKNPYVNIEANLNADRW
RRVLENTEIHVAVDDCDVLAPQARRFAEQLGLPVTDYDHDELVAATLSIY
GYSEDWLLDNGLAFAMAKFFYLH
botfb-a6rm08: Botryotinia fuckeliana (strain B05.10) (Noble rot fungus) (Botrytis cinerea) Predicted proteinBotryotinia fuckeliana Show
MEALKNLSLTTGTSIKETIFPTAKILAPYLQKNRDSILSVPRSTHTYGSH
TRQTLDLYPSTTASSTSPILIFFYGGGLTRGDKILDVPILDKLVYHNLGA
FFSKQGITTILPDYRRVDSETGGEGAVYPSGGEDVSAVLRWLSKTDLLDG
KGNKKDVYLMGNSAGGLHIATYLLESRFLEERKSWQGEEANVLLKGAVEV
GVPFSFEEALAGRKDMLEKYYGSDESVLAKCPSGLLKAVGESKKSREELG
IPNLLVMNSEYDPVDEILNPNDAFVKLGEEIWAEKIEVIKIQGHNHISPP
MALSTGEGEEWGEQVATWIKGNA
canal-q5a2u7: Candida albicans (Yeast) Potential esterase/lipase, 1 reference(s)Candida albicans Show
MGHLEYKLIEICLQFQYQLIKTSIEFIKTLSTLFIMISLRAVIALILLPL
NLLFVLIKYPFFGGVNPIYKNDLVNSLKLTVYQALINFPLDDVHIFSIIS
AEFVINKAVGKLYPGLTSKLPNYGKKFDKQSFWLVEKPNRKPDDPVLIYL
HGGGYFLGLVPQQIESLVTTYHLLDPVKRENLSILVLDYNLTCQGYPIPH
QLSQLVETYTNLVKEGGKNFLLMGDSAGGNLAITFTQYLRLSNSSNLPYP
KSSILISPWVKLIAETYQNTPGHSYYNYSSGDVTQYDTLSGAEVYQHILG
TETKLNSLTVSPGNCPYDSKDWQDIPTYNQPGHSVFVLAGEHETFRDDIL
EWSKYALNYPLDELDFQDSNGEFNPKVHKYIRNDENSAYIDVTIVPWGAH
DFLFFEHTLIGKLKSEPSLKLQSINKRKYFGTTSVVNFLNTVLPGEN
canal-q5ak09: Candida albicans (Yeast) Potential esterase/lipase, 1 reference(s)Candida albicans Show
MISLRALFDLVTLPIKLLLALLKYPIFGGVNKRYKNDLANSLKVILCRSL
INFPVKDTPIFATTPTGDMINKGIGKTYPNMTKLPHFGEKFDKQSYWLVE
SKNRKPNDPVLIYLHGGGYFLDVAPQQIETLLSIYHLLEPAKKSRFSILV
LNYNLTSKGFPVPHQLAQLVDTYTSLVRGGSENLLLMGDSAGGNLAITFT
QYLRLNKPNLPYPRSVILVSPWVKLIPEVYQNTPGHSYYNYSANDVIQYD
RFSSAEVYQGTLGNTKLKSLTVSPGNCPYDPKDWEEIDTYRKPGYSVFVL
AGEHESFRDDILEWSKYALDYPIPPNLGNSDGVYNPKIHKYIRNNKDSAH
VDVNIEPLGVHDVCFFENLLLSKLENDANLTIDGVDAKQFFAIVNIVKFL
DTVLPGK
canal-q5ak96: Candida albicans (Yeast) Potential esterase/lipase, 1 reference(s)Candida albicans Show
MISLRAIFAIISLPIKLLFVLIKYPFFGGINSMYKDDLSNSLKMILYRTL
IDFPKDDVHIFALMSTGFVMNSVVGKLDSSLTSKLPNYGKKFDKQSYWIV
EKPNRKPDDPVLIYLHGGGYFLGIVPQQIESMVTTYYLLDASKRENLSIL
VLDYNLTCQGYPIPHQLSQLVETYSNLVKNGAENLLLMGDSAGGNLAVTF
TQYLRLSNSVNLPYPKSCVLISPWVKLIAETYQNTPGHSYYNYSKVDMRH
FDTFSSADLYKHILGDTKLNSLTVSPGNCPYDPKDWDDISIYKQPGHSVF
VLAGEHETFRDDILEWSKCVLDYPIDKLDFKDSNGEFDPKAHRYIRNDAN
SAYVDVTIVPWGPHDYLYFDHSLIGKLKSEPTLKLNSINKRKYFATISVV
NFLNTVLPGKN
canal-q59l46: Candida albicans (Yeast) Potential esterase/lipase, 2 reference(s)Candida albicans Show
MHGTMITIDFFLKLVTLPYTVTKTVLQYYTVGTPYSRTNQEFRNSLWKNV
LLSVQYHVSGNYKKENIKAVIYQPIDKVIAKFKTHPLASGLAHFGEKFDE
YSYWIHKADTQGKVLIYIHGGGYLLNMFESQFVFVSALHYALDDHAAENT
SILVVDYSLTMFDNVYPTQLYEHLVTYNNLVAQGYKDILLLGDSAGAHMS
LSLARAIAYPEEAKQQLQQYNVSLDLPQPQALILVSPWVQPCTTPKLPPR
HGCDVWGDLGAQDTSMGELYAGDNDKSFINNFLTFTNTNWDEHWKEVEAL
NGNTLMIVGEREVLRDGVDDFYNIIKGGVEYYTEPGGIHAGLVYVECLDY
ISKQGAERAIKGDFKDKFAYNLVAKFINERV
canal-q59nx4: Candida albicans (Yeast) Potential esterase/lipase, 1 reference(s)Candida albicans Show
MLSFKGWKVLLSIPIKLLAVLLKYPFAGGVNKKFKYDLLNSLKLILYRTA
LHMPVRESALLSIMSNHFIINKLIKNLYPTLTKLPSYGKKYDKQSYWLVK
NRDRKPNDPILIFLHGGGYFFETMPCQIESLLSIYHVLDAPKRSSLSILV
LDYKLASRGYKIPYQLTQLIETYTNLVKDGNTNMMLMGDSAGGNLALTFL
QHLRLDHVNLPYPTSTILISPWVKLAPDEIQNTPGYSYHDNTPVDMIQVD
FFRDVEKQNAILGDIEHTELTISPGNCLYRHEDWEDIPSLVEPGHSVFVI
VGEHECFRDDVLEWCHFALKSPLTSQRDDSRGVFNPKIHEYIRNGNDFAY
VEVVVEPWGVHDSVLYFENTIISKVKKNPKLKVNLLNSHEYFGFIKLVNF
LNNVLPGSSQTKFV
canal-q59nx8: Candida albicans (Yeast) Potential esterase/lipase, 1 reference(s)Candida albicans Show
MISIQGLVILLSIPIKLLIVLLKYPFVGGINPKFRNSLIGSFKMTIYKTA
LTIPVRDSGLFSIMSNYFIINKLIKTLYPTLTSLPNYGKKYDKQSYWLVE
SKDRKPSDPVLIFLHGGGYFVQTMPSQIESLLSIYHLLEEPQKSKLSILV
LDYKLACHGYKVPYQLTELIDTYTNLVKDGSKNILLMGDSAGGNLALIFL
QSLKIDKLSLPYPSSVLLISPWVKLAPDNFQNTPGNSYYDNAAHDMLPFN
SHSSELLESLLGDSRVYSLTISPGNCPYNETDWKDIPSLNHPGYSVFVIT
GEHECFRDDILEWANHSLQSPLTPQKGDSQGRFNPKIHQYIRDTPDTAYA
EVLIEPCGVHDSVLYFENSIISILKNNPRLNAKSLDKVEYFGITKVVDFL
NKTLSSEEKKGVKPLL
canaw-c4ykb1: Candida albicans (strain WO-1) (Yeast) Putative uncharacterized protein, 1 reference(s)Candida albicans Show
MTLFIMISLRAVIALILLPLNLLFVLIKYPFFGGVNPIYKNDLVNSLKLT
VYQALINFPLDDVHIFSIISAEFVINKAVGKLYPGLTSKLPNYGKKFDKQ
SFWLVEKPNRKPDDPVLIYLHGGGYFLGLVPQQIESLVTTYHLLDPAKRE
NLSILVLDYNLTCQGYPIPHQLSQLVETYTSLVKEGGKNFLLMGDSAGGN
LAITFTQYLRLSNSSNLPYPKSSILISPWVKLIAETYQNTPGHSYYNYSS
GDVTQYDTLSGAEVYQHILGTETKLNSLTVSPGNCPYDSKDWQDIPTYNQ
PGHSVFVLAGEHETFRDDILEWSKYALNYPLDELDFQDSNGEFNPKVHKY
IRNDESSAYIDVTIVPWGAHDFLFFEHTLIGKLKSEPSLKLQSINKRKYF
GTTSVVNFLNTVLPGEN
canaw-c4yrn6: Candida albicans (strain WO-1) (Yeast) Putative uncharacterized protein, 1 reference(s)Candida albicans Show
MTIYKTALTIPVRDSGLFSIMSNYFIINKLIKTLYPTLTSLPNYGKKYDK
QSYWLVESKDRKPSDPVLIFLHGGGYFVQTMPSQIESLLSIYHLLEEPQK
SKLSILVLDYKLACHGYKVPYQLTELIDTYTNLVKDGSKNILLMGDSAGG
NLALIFLQSLKIDKLSLPYPSSVLLISPWVKLAPDNFQNTPGNSYYDNAA
HDMLPFNSHSSELLESLLGDSRVYSLTISPGNCPYNETDWKDIPSLNHPG
YSVFVITGEHECFRDDILEWANHSLQSPLTPQKGDSQGRFNPKIHQYIRD
TPDTAYAEVLIEPCGVHDSVLYFENSIISILKNNPRLNAKSLDKVEYFGI
TKVVDFLNKTLSSEEKKGVKPLL
canaw-c4yrn9: Candida albicans (strain WO-1) (Yeast) Putative uncharacterized protein, 1 reference(s)Candida albicans Show
MLSFKGWKVLLSIPIKLLAVLLKYPFAGGVNKKFKYDLLNSLKLILYRTA
LHMPVRESALLSIMSNHFIINKLIKNLYPTLTKLPSYGKKYDKQSYWLVK
NRDRKPNDPILIFLHGGGYFFETMPCQIESLLSIYHVLDAPKRSSLSILV
LDYKLASRGYKIPYQLTQLIETYTNLVKDGNTNMMLMGDSAGGNLALTFL
QHLRLDHVNLPYPTSTILISPWVKLAPDEIQNTPGYSYHDNTPVDMIQVD
FFRDVEKQNAILGDIEHTELTISPGNCLYRHEDWEDIPSLVEPGHSVFVI
VGEHECFRDDVLEWCHFALKSPLTSQRDDSRGVFNPKIHEYIRNGNDFAY
VEVVVEPWGVHDSVLYFENTIISKVKKNPKLKVNLLNSHEYFGFIKLVNF
LNNVLPGSSQTKFV
canaw-c4yrr3: Candida albicans (Yeast) Putative uncharacterized protein, 2 reference(s)Candida albicans Show
MNIYIYIYIYIKKSILISITISVPFLFHFSFYKKLIFFILFHFTSLHFIS
LPIMLTFKGLLLILLLPSRLLSFIIKYPFIKGIPGKYQHNFSKSLFIKLC
RLIQLLPVSDKGTLNFISTNFLLNKIMKLYHTRYFLGELNNFGKKFDDQS
YWIHESPNRNRNKNKSDDPIIVYLHGGSYYFDNSLNQMESLIGIYQLLQN
TTTITTTTTTNDDSTSVERKKNLSILVLDYKLASKGYKMPYQLNQLISTY
KNLIYQGNTNLILMGDSAGGNLAITFLQHLRLTNNNNNNNNNSPANLPYP
KSLILISPWCKIVPEISDYTKGHSMYDNNQYDIIEWKAVKKLIDNTSPLI
RDDLSPQNLIISPGNLPYNIDDWIDIDTLQKSNYSTFVIMGEYETLRDDI
LNWCQYAVNSTLSSPIKHTQGIFDKNIHQFVSTKNDGAYVKCIIEPKGIH
DASMIFENDILKEFQKHPKMNLQTINKDKYFGIYQIVEFLNEIL
canaw-c4yrv3: Candida albicans (strain WO-1) (Yeast) Putative uncharacterized protein, 1 reference(s)Candida albicans Show
MYKDDLSNSLKMILYRTLIDFPKDDIHIFALMSTGFVINSVVGKLDSSLT
SKLPNYGKKFDKQSYWIVEKPNRKPDDPVLIYLHGGGYFLGIVPQQIESM
VTTYYLLDASKRENLSILVLDYNLTCQGYPIPHQLSQLVETYSNLVKNGA
ENLLLMGDSAGGNLAVTFTQYLRLSNSVNLPYPKSCVLISPWVKLIAETY
QNTPGHSYYNYSKVDMLHFDTFSSADLYKHILGDTKLNSLTVSPGNCPYD
PKDWDDISTYKQPGHSVFVLAGEHETFRDDILEWSKCVLDYPIDKLDFKD
SNGEFDPKAHRYIRNDANSAYVDVTIVPWGPHDYLYFDHSLIGKLKSEPT
LKLNSINKRKYFATISVVNFLNTVLPGKN
canaw-c4ys26: Candida albicans (strain WO-1) (Yeast) Putative uncharacterized protein, 1 reference(s)Candida albicans Show
MISLRALFDLVTLPIKLLLALLKYPIFGGVNKRYKNDLANSLKVILCRSL
INFPVKDTPIFATTPTGDMINKGIGKTYPNMTKLPHFGEKFDKQSYWLVE
SKNRKPNDPVLIYLHGGGYFLDVAPQQIETLLSIYHLLEPAKKSRFSILV
LNYNLTSKGFPVPHQLAQLVDTYTSLVRGGSENLLLMGDSAGGNLAITFT
QYLRLNKPNLPYPRSVILVSPWVKLIPEVYQNTPGHSYYNYSANDVIQYD
RFSSAEVYQGTLGDTKLKSLTVSPGNCPYDPKDWEEIDTYRKPGYSVFVL
AGEHESFRDDILEWSKYALDYPIPPNLGNSDGVYNPKIHKYIRNNKDSAH
VDVNIEPLGVHDVCFFENLLLSKLENDANLTIDGVDAKQFFAIVNIVKFL
NTVLPGK
candc-b9wa64: Candida dubliniensis (strain CD36 / CBS 7987 / NCPF 3949 / NRRY-17841) (Yeast) Esterase/lipase, putative, 1 reference(s)Candida dubliniensis Show
MITIDFFLKLVTLPYTVTKTVLQYYTVGTVYSRTNREFQGSLWKNVLLSV
QYHVSGNYKKQNIKAVVYQPIERVIAKFKKHPLALALNHFGEKFDEYSFW
IHKSEDPNAKVLIYIHGGGYLLNMFESQFVFVAALHYALDDRAAEKTSIL
VVDYSLTMFDSVYPTQLYEHLVTYHNLVAQGYKEIMLLGDSAGAHMSLSL
ARAIAYPEEVEDQLARHGFKVGFSVGDLPQPETLILVSPWVQPCTEPKLP
PRHGCDVWGDLGAQDTTMGELYAGDNDKSVINNFLTFTNTTWAEHWKEVA
ALNNGNTLMIVGEREVLRDGVDDFYEIIKGSVEYYTEPGGIHAGLVYVES
LDYVSKHGAQRAIEGDFTDKFAYNLVAKFINERV
candc-b9wc93: Candida dubliniensis (strain CD36 / CBS 7987 / NCPF 3949 / NRRY-17841) (Yeast) Hydrolase, putative, 1 reference(s)Candida dubliniensis Show
MISLRGIFAFILLPIRLLFVLIKYPFFGGINNLYKNDLINSLKLTFYQAL
INFPLNDVYIFTLISSEFIINKVIGKLYPSLTKNLSNYGEKFDKNSYWLI
EKSNRSSNDPILIYLHGGGYFLGIIPQQIESLITTYYLLDPIKQRNLSIL
ILDYKLTSHGYPIPHQLTQLLETYTNLVKQGNENFLLMGDSAGGNLAITF
TQYLRLSSNNNNNNNSSNSNSSNLPYPKSLILISPWVKLIAETYQNTPGH
SYYNYSSGDVIQFDRFSSSELYQNLLGTDTKLNSLTVSPGNCLYSREDWE
NIPTYNQLGHSVFVISGEHETFRDDILQWCKYSLNYPVDELNFKDSNGEY
DPKIHKYIRNDEKSAYIDINIIPWGLHDYLIFEHTLIGKLKLDPSLKLQS
INKRKYFGTLSVVNFLNTILPGEN
candc-b9whs3: Candida dubliniensis (strain CD36 / CBS 7987 / NCPF 3949 / NRRY-17841) (Yeast) Esterase/lipase, putative, 1 reference(s)Candida dubliniensis Show
MLSFKGWKILLSIPIKLLSVLLKYPFSGGVNKKFQYDLLNSLKLILYRTA
LHMPVRESALLSIMSNHFILNILIKTLYPTLTKLPNYGKKYDKQSYWLVK
SRDRKPSDPILIFLHGGGYFFETMPCQIESLLSIYHVLDAPKKSNLSILV
LDYKLASRGYKIPYQLTQLIETYINLVNDGNTNMMLMGDSAGGNLALTFL
QHLRLDHVNLPYPTSTILISPWVKLAPDAIQNTPGYSYYDNTPVDMIQVD
FFRDVEKQNAILGDIEHTELTISPGNCLYRHEDWEDIPSLVEPGHSVFVI
VGEHECFRDDVLEWCHFALKSPLISQRDDSKGIFNPKIHEYIRNTDNFAY
VEVVVEPWGVHDSVLYFENTIISKVKKNPKLKVNSLNSHEYFGFIKLANF
LNNVLPGSSQPKSV
candc-b9whs6: Candida dubliniensis (strain CD36 / CBS 7987 / NCPF 3949 / NRRY-17841) (Yeast) Esterase/lipase, putative, 1 reference(s)Candida dubliniensis Show
MSLSRYTYKTNASSFGIVSKPNFYSKSNDYFFYAIAFSLSLIREFIVKKM
ISIQGLVILLSIPIKLLIVLLKYPFVGGINPKFRNSLIGSFKMTVYKTAL
SIPVKDSGFLSIMSNYFIINKLIKTLYPTLTTLPNYGKKYDKQSYWLVES
KDRKPSDPVLIFLHGGGYFIQTMPSQIESLLSIYHLLEEPQKKKLSILVL
DYKLASHGHKIPYQLTELIDTYTNLVKDGSKNILLMGDSAGGNLALIFLQ
ALKIDKLNLPYPSSVLLISPWVKLAADNIQNTPGHSYYDNAAYDMIPFNS
HASEVLEYLLEDSRVYSLTISPGNCPYHETDWKDIPTLNHPGYSVFVIAG
EHECFRDDVLEWANHALQSPLTPQKGDSQGRFNPKTHEYIRDIPETAYAE
VVVEPWGVHDSVLYFENSIISLLKNNPRLNVKSLNKVEYFGITKIVGFLN
KTLSSEEKKGVKPLL
candc-b9whv2: Candida dubliniensis (strain CD36 / CBS 7987 / NCPF 3949 / NRRY-17841) (Yeast) Esterase/lipase, putative, 1 reference(s)Candida dubliniensis Show
MITFKGFFLILLLPTRLLSFIIKYPFIKGIPGKYQNNFSKSLFIKLCRLI
QLLPISDKGTLNFISTNFLLNKIMKYLYHTRYFIKDLNNFGEKFDDQSYW
IHESINRCKNDPIIIYLHGGSYYFDNSLNQMESLLGIYQLLKNSSSQLKD
NNNNNNDDDDDVNKDKMKRKNNLSILVLDYKLASKGYKMPYQLNQLISTY
KNLIYQENTNIILMGDSAGGNLAITFLQHLRITNCKNLPYPKSLILISPW
CKIVPELSDYTKGHSMYDNNKYDIIEWKAVKELIQDTTPLMGDLSPANLT
ISPGNLPYNHQDWESIDTLKQSGYSTFVIMGEYETLRDDILNWCQYALNS
NLSSPIKHTQGIFDNNIHQFV
candc-b9wi60: Candida dubliniensis (strain CD36 / CBS 7987 / NCPF 3949 / NRRY-17841) (Yeast) Esterase/lipase, putative, 1 reference(s)Candida dubliniensis Show
MISLRALFDLATLPLKLLIVLLKYPIFGGVNKRYKNDLANSLKVILCRSL
INFPVKDTPIFATTPTGDMINKGIGKSYPHRTRLPHFGEKFDKQSYWLVE
SKNRKPNDPVLIYLHGGGYFLDVAPQQIETLLSIYHLLEPAKKQRFSILV
LNYNLTSKGYPVPHQLAQLVETYTSLVKGGAENLLLMGDSAGGNLAVTFT
QYLRLNKTGLPYPKSIILVSPWVKLIPEVYQNTPGHSYYNYSANDVVQYD
RFSSAEVYEGTLGDTKLKLLTVSPGNCPYDSKDWEDIDTFKKPGYSVFVL
AGEHESFRDDILEWSKYTLDYPIPSSLGDSGGVYNPKIHKYIRNNKGSAY
VDVNIEPLGVHDLCFFENLLLSKLENDPSLTIDGVDPKQFFAVVNIVKFL
DTVLPGN
canga-q6ftv9: Candida glabrata (Yeast) (Torulopsis glabrata) Similar to uniprot|P53324 Saccharomyces cerevisiae YGR263c, 1 reference(s)Candida glabrata Show
MDTKSNVSVNTTEIPTNITVTTDLSTLRNEEDSITMSIWHTLRFLSKFIG
ILPFKMTYYLIKVVMESERGVNIDIVSRIFMRESTKLIDENICQYVLNPI
FEFIYKFEGNGISLINYSVPNDDLEQISGGIFDKPFVKSTRTQSKFFWKR
QINPHTFNPEIDPILIYYHGGGYALQLTPTTLSFLTNTGKYFPDMPILIS
DYATTASKLDSNKYPRQLLDILAVYDYVTQSLGCKNVIVMGDSAGGNAVL
VLLLYLHKHNRPLLPRKAIPISPWLNTTYIGEQERTYMKQSEKWDGICTK
GSEMFGDLYIPKILRESGYNPDNDEYINIEHNFDAETWNLITEKCDLLVT
YGDDEILSYQIKLFVDKLIECNPKRYNNVENVLAHFQGCHTGPILAWDGN
VESWSKQTMIKPILDFIDKA
cantt-c5m5e8: Candida tropicalis (strain ATCC MYA-3404 / T1) (Yeast) Putative uncharacterized protein, 1 reference(s)Candida tropicalis Show
MISIDFLAKLLSLPYVVIKAVLQYYTVGTIYSRTNIEFRNSLWKNVLLSV
EYHMSGNYKKQNVKAVVYEPVEKVFKQVAKNPMVKSLNGFGEKFDARSYW
IHKSDNPSGKVLVYLHGGGYLLNLFKSQLVSIAALHYALDARVADELSIL
VVDYSLTLFDHVFPAQLVESLESYTNLIKAGFKDIHLIGDSAGGHLAVNM
QMAIANPKETKEMFADFGYDGGALDGKLVAPKSLSLLSPWVQPTVAPIVS
PGVNTWGDLGALDTTLGELFVEGIPKDQLARYNRYINLCNVPPLPETLVI
VGEREVLKNGIDMFVADAQGPIEYHEEPGGIHAAMVYVEGLDYSGNKGAK
RAIAGDFTNKFAYNLVAEFLSRNV
cantt-c5mh80: Candida tropicalis (strain ATCC MYA-3404 / T1) (Yeast) Putative uncharacterized protein, 1 reference(s)Candida tropicalis Show
MFTPLGFLQVLLIPVKVLIFAILYPFQGGVPGKYVDDFKRSLVLVICRAA
LKLPPQDKGMLSFLSVDYILNTIMKFMHPELTKLNNFGKKYDNQSYWIVE
APNRSKHDPILIYLHGGVYYFGVSPPQIEGILGIYHLLESNKRKKLSILV
LDYKLASKGHPMPAQLGDLVTLYKKLVDEGNDNIQLIGDSAGGNLAITFL
QHLRISNEKLPYPRNLVLISPWCKIVPDASDHTPGHTFFDNDAFDILCWE
NSKGFLIDPTPLMGSTDPRSLTISPGNCTYNYSDWEDIPTLNEPGYSTFV
ILGENEALRDDILRWCQFSLKSPIPLKIESCGPEEKVFIKNDPTSAKTKV
VIEPDGIHDGAMVVETDLIQLLDENPNTTVESLDDDRYFGMIEIVNFLNN
VL
cantt-c5mh89: Candida tropicalis (strain ATCC MYA-3404 / T1) (Yeast) Putative uncharacterized protein, 1 reference(s)Candida tropicalis Show
MISLKTIGIFLSLPVKLLWVVIKYPFVGGINNKFKNDLINSLKLTIFRSA
LGFPTEDKGKLSITTNEYLINSIIAKQYPNLTELLNNYGKNYDDNSIWIV
EAENRSKQDPILIYLHGGCFVFESAPSQIEGLLTFYNLIDEEYRKKLSIL
FLDYKLASKGYNVPYQLNQLIETYTKLVNEGNNNFITLGDSAGGTLILTL
LQKLKHDETLKSFPFPKSSIMLSPWCKLVPDNEDYYLPNHSMHDNSTFDM
MQIHHYQQMFSVQGIKQIFRNNDIKSLTISPGNCNYSISDWEKIPTFNDP
GYSTLVILGEDETMRDDILQWCKYALGSTLTPQRESSNGVWISDIHEYIR
DDKQLSYVDVVVEPFGIHDGFFMFESGLLGDINKGKPVNVNELDKIKYFG
TVKIVEFLNKVLSNSETKKTV
cantt-c5mhh0: Candida tropicalis (strain ATCC MYA-3404 / T1) (Yeast) Putative uncharacterized protein, 1 reference(s)Candida tropicalis Show
MLSFKGFRILLSIPIKLLLVLLKYPFFGGINEKFKNDLINSLKLIIYRTA
LYMPVRESAVLSIMSNRFILNNLIRKLYPKLTNLPNYGKKYDNQSYWIVK
PFERSNNDPILIFLHGGGYFFETMPSQIESIISIYHLLDKSKREKLSIMI
LDYKLASRGYPVPYQLGELVDTYSNLVKEGNNNFIFMGDSAGGNLAIIFL
QYLKLNNVEHLPYPKSVLLISPWVKIAPEEHQDTPGHSYYDNSHRDMLQI
DHFRDVDKQIHILADTKHVSLTVSPGNCDYKHTDWEDIPTLNDSGYSVFV
ILGEHECFRDDVLTWCKYALKSPLTPQKKDSNGIWDPKVHQYIKDQFNSA
YIEVDVEPHGVHDSVLYFENNIISKVKKHPYTSISTIDPHKYFGIVKVVT
FLNRILPSEKVEDLV
clal4-c4xy03: Clavispora lusitaniae (strain ATCC 42720) (Yeast) (Candida lusitaniae) Putative uncharacterized protein, 1 reference(s)Clavispora lusitaniae Show
MISLSFLKQLLTIPVAIVSAVVKYYTTGTVYSTTNKEFANSLYKNVHMSV
LFHLANTYNRDDVATFIYRSTQSHFKKFKSHPLAVGLNGFGESIDPRTTW
VVKNGSAAASEKSAVLFLHGGGYCLNVFSTQFIGIMALYYAVPEPEREKL
SIAILDYSLTCHYKKFPTQIFEAIHAYRELVNQGYTKITLLGDSAGTNLA
CAVARFIAYPEEAKATFSKFADFDWDFSPLPQPENMIFISPWLEPCTVPK
YLPGVDTAGDLGAIDTSFGDWYVEGLNLDEIKPFVQFTNTTYEKHWANVD
AFNGKGRCLYLYGAREILREGVERFADIITKEGSGKLEVYVEAGGIHDAL
FYVESLDYLGKSGAQRALEGDFSSKFAYSLVGEFLAELVK
clal4-c4yba6: Clavispora lusitaniae (strain ATCC 42720) (Yeast) (Candida lusitaniae) Putative uncharacterized protein, 1 reference(s)Clavispora lusitaniae Show
MSYVCRKSSRALVHRGCKMSQCGVQGYIKRQWSFKTTSHDMLVPSCDTIR
HYQQFLRSLLVLAKMPLDIFIVVLRFYIFGGIHYRKYSKSLLNCIKLTIF
RASLTIDIKHAYLLAPYSNSFLLRRILPFVGKDLVKNVPGYGSRYDKNSI
WMAKSGTSKADPVIIYSHGGGYFIQTQVTQVRSLMSVYHLLEPKKKSKTS
ILFLDYTLVGRGKPFPTQLMQLHSTYSNLVSEGHTNIILMGDSAGAHLSI
SYTQYLKTLQTEKIFPKKLLLISPWVKITPLPTELVEGRSWLQNQHYDMI
HYTRFTNSDDIPPIFGEQDPFSLVFGLMAKVPKQESDWKDIPNYSSPDND
VFLIFGEDESFRDDILEFAKYALDLPWYEKVKYGDSHKYLERNHYEYERR
NESGKCNLSVFVEPLGVHDSMLFFEDVVASQICGRLRQVKSISVEEIDSK
KYFGISRLVRFLNETL
clal4-c4yba7: Clavispora lusitaniae (strain ATCC 42720) (Yeast) (Candida lusitaniae) Putative uncharacterized protein, 1 reference(s)Clavispora lusitaniae Show
MSAMSPCIKSTACACSQIYKCRFSCRLSCRPCCLMFQNKFLHSLFIVLSI
PWDILVVTLRYYIFGGLNYRKYESSLLNCIKMRVLKASLAIDMEYSYLLA
PYSNGFLIRWMLPMFCSTLVKDLPGLGYQYDENSLWLVKQSQSTKTDPVI
IYAHGGGYFIQTIITQLKSILAVFHLLEPEIKSKTSILFLDYKLVGGGHP
FPTQLEQLHATYCRLLDDGYSNISLMGDSAGGHLSVSYTQYLKSLNRPVE
YPKNLILISPWLNVAPQPNELVKGRSWIDNKDYDLIHYSRYAHIENLATI
FGDVDPFSLVHGIMAKVPKQRSDWDDIPNYSNKDYHTFLIFGEHESFRDD
ILEWAKYAFDLPWYEAVTYGNSHKLFSRQHYEFKRRNKDGNASLTAYVEP
LGVHDSMLFFEDGVADQIADNIRSGRPNSADDVDPVRYFGVVRLANFLNE
TL
copc7-a8nkc7: Coprinopsis cinerea (strain Okayama-7 / 130 / FGSC 9003) (Inky cap fungus) (Hormographiella aspergillata) Putative uncharacterized protein, 1 reference(s)Coprinopsis cinerea Show
MPSYKLNRRAQCQQVSLILTMAKYAGISWFDFLGFAGTFATLPFYVLWSV
LVTALKKRRLTGLRKAALTSSARYINTRSSVAQLQYLSGTSPSVYASWAR
RHGFPAVIEDLRHDARLYWLGPKRTDKVILYIPGGAFFAPILSVALSFWN
YVRKSMGGEGDVGLVVLQYSVLPEAGFPTQLRQICGAIDHLLQSGTRPDN
IHIVADSAGGNLVLQFFSQLLHPLENANVEPIPALRKPFGSVYLLSPWTN
LQIAEQRGQKSADVINTKVLKVWAKSYIDTIPKGQEHYASFLTPGKEDWF
TGLGQFCNRIMVSFGGDECIKDDGVDVARSRLSQDGVDLRLEIQEGGVHD
DPFWDFTSSDNPSSVGTLTPIIVEWLKEGLYSRS
debha-b5rue8: Debaryomyces hansenii (Yeast) (Torulaspora hansenii) DEHA2F11968p, 1 reference(s)Debaryomyces hansenii Show
MISLSGLLTLLGIPIRALILAVKFYTVGLPYRKYSNSLKRCLRLLVFRTA
LSLSVFDAYYISFMSNDFVINKIVPLFHKSITSKLPGYGTRYDKNSLWLV
KQPNREPGDPILIYIHGGAYFLQTQPEQIESVLSMYKLIKPDKQARLSIL
LLDYKLASYGYPFPTQMNQLHETYSNLVTNEGNTNIILMGDSAGGNLTLG
YLQFLKKTQLENIVYPSKLVMISPWVKLKPTPDIMVPGNSFYDNSDRDMI
AYSQFSEMNKILHITDGNNLNSLQVCPGVNPTQEENWDDIPTLKDPNYDV
FVLAGEDESLRDSILDWCQYAFDVPLNTQYKYGNSNNQFDKEGYEYIRKN
DPGSCHLRLYIEPWGIHDSCLFFENHLISKIKKQESDPKKSSLDVNHIDD
KEFYGLTRIVQFLNDTL
debha-b5rue9: Debaryomyces hansenii (Yeast) (Torulaspora hansenii) DEHA2F11990p, 1 reference(s)Debaryomyces hansenii Show
MISLSGLLTLLGIPVRALILAVKFYTVGLPYRKYSNSLKQCLRLLVFRTA
VSLSVFDAYYISFMSNDFVINKIVPLFHKSITSKLPGYGTRYDKNSFWLV
KQPNREPDDPILIYIHGGGYFLQTQPDQMESVLSMYKLIKPDKQARLSIL
LLDYKLASYGYPFPTQMNQLHETYSNLVTNEGNTNIILMGDSAGGNLSLG
YLQFLKKTQLENLVYPSKLVLISPWVKLQPASDVMVPGNSYYDNSERDMI
AYSQFGDPKKVVHITGEGDLDSLQVCPGARPTQVENWNDIPTLKDPRFDV
FVITGEDESFRDSILDWCQYALDVPLNTQYKYGNSNNQFDKEGYEYIRKN
DPGSCHLRLYIEPWGIHDSCLFFENHLISKIKKQESDPKKSSLDVNHIDD
KEFYGITRIVQFLNDTL
fusox-w9ibd7: Fusarium oxysporum Uncharacterized protein, 1 reference(s)Fusarium oxysporum FOSC 3-a Show
MDRLPALGTDIKAVLSPTMQIYTELLQQNAPAIHSVSKERETHQYGQHPR
QNLDLYKPKENSANSPVILWAHGGGLVAGDKNLPIPGDLVYSNAGYFFAS
RGFTAVVINYRLVNTHDAKFPSGGEDIAAAIEWITEHFQGQKRDLFGLGN
SAGGIHWSTFLFHPAFQSTLNKVTIGDGVRLRGVTLLSVPFDFSKAAPDR
ADVLHSYYGDDLAQKCPYGLMYLADDAVWESLERGKVQIHVGSVSLDPED
EILSPVRCFISTWRNKRSSSPAPGLVVSTWGGHNHISPFLALGTDIAREE
SWGNDLVEWMRGEIEGSAN
klula-q6cm49: Kluyveromyces lactis (Yeast) (Candida sphaerica) KLLA0E23013p, 1 reference(s)Kluyveromyces lactis Show
MTVKETLVGIVILSCALPIALCKWSRSLNKTSMPRGRLFLVTLTRVICDA
SNPAIIRYILNPWMGLLSWLLFQAYRFPKHNHSGYWLRTAPVDRKPGVDK
KLLLYVHGGGFMFGLIPWMLIVLWTVGKKLDDDVAILVLDYPVMANCPET
IDYVWKEYLELTETFTEINLIGDSCGGNLILNILLKCHENKMTIPKRAIA
ISPWCNVLDRDSVDVERLNGYNVDMLSMKVLTVFQNSYMQNVVDPSQYLK
YLNFTSIPRETWTEILSDTKLFITYGDLEMFKNQIELFINHISPNENLIA
EIFPCGSHIEPLVLGYHQSLDKWAKFLSKSDETSF
lactc-c5dif7: Lachancea thermotolerans (strain CBS 6340) (Yeast) (Kluyveromyces thermotolerans) KLTH0E12166p, 1 reference(s)Lachancea thermotolerans Show
MIEPIIFFSKLAFRLPYSLVKAWVGGSLAELGSSKAVARVFLSEFAENLD
PVTLRWVVNPVLRSVNVLSLWWLGAAGSDGRLRWLYKEEGAPVLLYVHGG
GMCVDMFACSLGYLKLLKKEIGHLSIAIADYSLCARYPQAIEDVWTEYKK
IIDEHKEVWLMGDSAGGNLGMNILQRCASDYTRFPEKCVLISPWLNVTKS
ETSFAHPGTDDYLTRNQLAMFKNVYAPNGSHQDPFLNIEANFDDGLWTTI
MRHTKFIVLCGSDEILCPEIIRLCSKLAKIDEDRVKMCMEPRGVHCNTLL
FDAWDPYAEHSSFPEILRFLRSDFYEKA
lodel-a5duy7: Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Putative uncharacterized protein, 1 reference(s)Lodderomyces elongisporus Show
MVSLDFALKIATIPYPVLSCIIQYYTIGTPFSRTNKEFKNSLYKNILLSI
EYHVSGNYHKNDMKLVVYQPIEKVIKKFNKHLLAKQLNAFGTKFDDHSYW
IHKAEVPKEETNVLIYLHGGGYLLNMFESQFVFITALHYALDDNAAAKTS
IMIIDYSLTMFDNEYPTQLFECLTTYKNLVQDGYKNIILLGDSAGAHMSL
SLARAIAYPEEVKEQLEPFPKYKLNFNVSELPQPKALILDAPWVQPCTKP
TIPTRHGVSTWGDLGALDISLGTFYLGKNDPKFINNFLTFTNTNWEDHWA
KVDPINNGNTMMIVGEREILRDSAEDFYNLVNKKGSIEYHTEPGGIHAGV
VYVESLDYTSKKGAKRAIAGDFKDKYGFNLIADFINKRSS
lodel-a5e2s1: Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Putative uncharacterized protein, 1 reference(s)Lodderomyces elongisporus Show
MISLQGIWVIITFFLEAAILILTYPILGGINPKYKHSLKQSLKLLFFRKQ
LSLPIPDAKYLTLYTNPFLLNNIIGNLYPGIVKNLHNYNKRYDQQSIWIN
EAPNRKPDDPIIIYLHGGGYYGQTLIAQIEGLLSIYQLVDPAKRARLSVL
LLDYSLASNGYKLTTQLYELAATYKRLTEQEGNTNIILAGDSAGGHLAVT
FTQWIHSEQGGSWTYPRSLVLLSPWVKLAADKVQHTPGHSYHDNEKKDLI
QYSWFSQASRAQALKGELNHKTLTVSPGNCPYKQSDWDQIPTFSKPGYSV
FVIAGEHESFLDDIIEFAKYAVDSRLPKPKQDSRGIFDPHVHEYKREEPN
GPYVDVIIEPWGVHVGSLNFENEIVNKVNDDPNLKLSDLDEVKYFGIVKI
VKFLNKVLE
lodel-a5e2t8: Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Putative uncharacterized protein, 1 reference(s)Lodderomyces elongisporus Show
MLSARAFYVLLSIPIKLLWVLLRYPFVGGINEKFRNSLRNSLKLQLYRTA
LSMPVKDAHILGILSNYFLINKLIKTLYPNLTRNLNNYGKRYDKQSFWLV
EATNRSKNDPILIFLHGGGYYIETMPEQLESLLSIYHLVDSEKRLKLSMV
FLDYKLASRGAPVTTQLYQLAEVYEKLTIRDGNTNISLIGDSAGGHLAIT
FLQYLKQQQNEKLPWPKSNILISPWVKLHPEPHQGTKGWSYFENSKRDII
QYRYFHEIDRQKAIIGDVTHLRYYEESGHQKIKKEDLDHLDMLISPGNLT
YKYSDWEDIPSLNDKGHSVFVVLGEHEVFRDDILEWCQYALKSPLIKQKI
DSKGVLDAKLHNYEDNGGNLNGAHVQVFVEPWGVHDATLFFENNIASKLK
RNPRLSLKDLDRKEFFGVVRIVEFINKYV
lodel-a5e2v2: Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Putative uncharacterized protein, 1 reference(s)Lodderomyces elongisporus Show
MISLNGFFVLLSIPIRLLWTIFKYPFVGGANEKYKNNLTASLRLEMARGA
LKIPICDAAVISLKNADAIINTVVPSRVPFLVQGLKKYGQRFDKQSFWLV
EAEGRSNDDPILIYLHGGGYYIDVQKTQIESVLAIYHLLEPKAKSKLSIL
DLDYKLVFEGHHITTQLYQLAETYEKLVRAGNTNIILMGDSAGGHLAITF
LQYLKQLDSKVTVWPRSAILISPWVRIRSDPAHYLPGNSWYDNSPRDMIS
FTGMQQKSRQAALVGNLDVANMLVSPGNLPYKNSDWDDIPTLNYSGYSAF
IILGEHELFRDDVLEWSKYAVKSPLRKQSKDSGGILNETVHIHRSGSFTN
NTGGAYVEVVVEPWGIHDAAMVVESNVAFKLGNDKLTVADIDNNEFFGIT
RIVDFLNKIL
macph-k2ryd3: Macrophomina phaseolina (strain MS6) (Charcoal rot fungus) Carboxylesterase type B, 1 reference(s)Macrophomina phaseolina Show
MDQLPKISATVQDSVIPTFEIYTKLLEANASNIGVTAKTRQTYSYGPHER
QTLDLYTPEDASDTAPIVLWVHGGGFVMGDKNLSAIPGDLVYTNVGHFLA
SHGITGIFMNYRLVFRHGAVFPSGGEDVALALEWITKHFAGQKRDLFGLG
NSAGAVHWSTFLFHNAFATTLERVTTGNDVRLRGVVLQSAPFDFTKAGPS
RQPVNKAYFGDDVEGKSPYGLMTSADNSTWELLVRGKVQFNVITFELDPD
EIKEPARRFVKAWNEARPRTGAHELAITEHEGHNHISPYTALGTGIEREE
AWGKRLVEWMEAVRRG
neucr-a7uwy7: Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) hypothetical protein, 1 reference(s)Neurospora crassa Show
WREHVTANFRGIWVIKDPLATPDFVLYYAHGGGFSMGSAYFYLEFLLSWA
SVLSSSGFKNPAIFALDYTLVPDASYPTQIQEAIEGYRYVLKVARDPAIV
CVSGDSAGATLILSLLLHLSCKDASAKRYGVGLPMPGLAVLISPWTTLVS
SRHTNTTSDYLNAEQLSTYGKQFAGNKMSWSDPLVSPGCCNDAAWWRRAS
PSNGIFITYGEEEVFSPEIHGLIARLNEAGLRVESEVEEGGIHAWPVASL
FLSTAREKRLKGVKGLTMEIRKRLSTSDAAKPM
penmq-b6qb64: Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) Putative uncharacterized proteinPenicillium marneffei Show
MTAISQQPAPGSLTLWGWLCLLAKVGRIVAGLIFKVARYPFLAKESKTKR
SFHHYIAYEGMIDFQSSLSSIEKHAVLPSTAWQCTSFAHGNNVPYERLTL
QDGTLAFLLNGSSSSTKHSVGLNPFTRGSKKAAALAEEMIVAKQKTNKVI
VYFHGGGYVAPILPQHIRLIYSFEDKPCYKEGVAVYILAYGLVTEHTNQY
PTQLRQAISLLDHIINTENISPSNITLMGNSAGANLLLAVLLHLSHPNPD
VPPLNMKDDEKFAAAVAISPWCKMDTSAKSMTTNANRDVLAASALEYWGG
NFLGGRLLDPWNSPLEAPAEWWTDLKVGEILMLYGEDEIMKD