9actn-a0a0h4c1q3

Streptomyces sp. PBH53. Hydrolase

Comment

Relationship

Family : Tiancimycin-TnmK-Tripeptidase-HIP

Block : X

Position in NCBI Life Tree : Streptomyces sp. PBH53

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MRIGRLAPLLAVGVTATLVPALAPAQASAAEPLRRFETQK
PDWRRCDASQ PAAFQCATIQVPLDYSRPDGKTIKLAVSR
VKTSVPGKRHGALLFNPGGPG GEGLDMPFVLKDMLPKKV
REQYDLIGFDPRGVGRSSPVGCRLTAAEENSE RPYKAET
LSRDVKWARTVADKCRTRNGDKLPYITTRNTARDMDVIRA
VLG EKKLSYLGYSYGTYLGAVYAQLFPERTDRFVLDSAV
DPARVWRGMIQIWA EGSEPAFTRWTKWTAQRHRTYQLGK
TPSQVRKTFWNLVARADRTPIEEGG QKITGDDIRAGLRQ
AFFSPQYAAEAVVDLKKAAAGHGSGRSGLLPGGSDP APR
WSASTAASSAAQPPADNGSAAFWSVVCGDTAAWPRDPEQY
RRDAIRD KAKYPLYGDFASNITPCAFWDKPAEPVTAVGN
KVPLLVVQNQWDSQTPLA SGIGMHRALKGSRMVYVKGGE
GHGVYSGDSGSCADRAVNAYLTTGKLPSR DVTCKPPAGG
QGLGVKPSLTPRL

References

Title : Draft Genome Sequence of Streptomyces sp. Strain PBH53, Isolated from an Urban Environment - Gosse_2015_Genome.Announc_3_e00859
Author(s) : Gosse JT , Hill P , Dowd SE , Boddy CN
Ref : Genome Announc , 3 : , 2015
Abstract : Gosse_2015_Genome.Announc_3_e00859
ESTHER : Gosse_2015_Genome.Announc_3_e00859
PubMedSearch : Gosse_2015_Genome.Announc_3_e00859
PubMedID: 26227608
Gene_locus related to this paper: 9actn-a0a0h4bxi4 , 9actn-a0a0h4clb1 , 9actn-a0a0h4c1q3