9bact-a0a1c9t7d3

Uncultured bacterium clone C9 carboxylesterase (est)

Comment

"This enzyme from moss-associated microorganism hydrolyses PBAT although much less than EstB3 C7 B11 and G4 which are not alpha\/beta hydrolases but belong to bacterial Family VIII Beta-lactam-related or GDSL"

Relationship

Family : Hormone-sensitive_lipase_like

Block : H

Position in NCBI Life Tree : uncultured bacterium

Molecular evidence

No mutation

No structure

No kinetic

No disease

No inhibitor

Database

Sequence

Peptide

MASWQSKILNPVIRALVKRKLLKTHDAAGIRKAFGGVLPP
PRGAQFSADV VGGMPGEWAKSGGAAAGTMLYLHGGGYVG
GSTATHRPITAAFAIRGLDVF VPDYRLAPENAFPAAVDD
GLAAYKGLLDAGIAPAKLTIAGDSAGGGLALA ILLAAKA
EGVTMPACAILLSPWTDLAVTGETVRTNLDRDPMLTDSVL
KDN AAFYLNGADPKNPLASPLYGDLAGLPPLMITAGDTE
VLLEDSTRFAARAR EHGVAVSLKIWEGMPHVWQLFQRVL
PEARAAIEEAARFAKAHFST

References

Title : Discovery of Polyesterases from Moss-Associated Microorganisms - Muller_2017_Appl.Environ.Microbiol_83_e02641
Author(s) : Muller CA , Perz V , Provasnek C , Quartinello F , Guebitz GM , Berg G
Ref : Applied Environmental Microbiology , 83 : , 2017
Abstract : Muller_2017_Appl.Environ.Microbiol_83_e02641
ESTHER : Muller_2017_Appl.Environ.Microbiol_83_e02641
PubMedSearch : Muller_2017_Appl.Environ.Microbiol_83_e02641
PubMedID: 27940546
Gene_locus related to this paper: 9bact-a0a1c9t7d3 , 9bact-a0a1c9t7d1