9neop-b6d7h0

Liposcelis bostrychophila Esterase 1

Comment

Relationship

Family : Carb_B_Arthropoda

Block : C

Position in NCBI Life Tree : Liposcelis bostrychophila

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MGQLGIVLSIACNKLCLNLKELFTFRVETVNVKTAEGELK
GRKLQSAFDK TYYRFQGIPYAKPPVGKLRFKDPEPPEPW
EGVRSALKEGAVCTHLDVITG LKKGSEDCLFLNVFTPQL
PGDNSETQGGKAVLVWIHGGGFQLGSGNAEIY SPDYFLN
EDVILVTLNYRLGVLGFLSTGTEDAPGNAGLKDIVMALKW
IQR NIAAFGGDPNKVTIFGESAGGVAVHFLMLSPMAKGL
FRGAISQSGAAVCP WAMCEDPVDTAFRLGKAFGIDTKDP
KVLVDSFRKISSKVLARKQGAAVSE QSKRECIPFAFLPC
IEPEGPNAFLTRHPADLIAEGNIASDVPYITGINEK EGL
IMLKTIVDKKPPAADIEKDFERLVPRFLKLEYGSEESKKV
AEKIREF YFSGKTFDKNTHGEYVNLMTDTQFLEGAHRTT
KHHTTHGRAPVYNYEFVF EGELNLFKKLLSIKGIPGPAH
ADELGYLFYVPILGPNLDPKTAEMRVVKR MVRLWANFAK
FLNPTPDASDPDLDHIKWEPHTDDHQKYLIIGEELRAAEN
MKEERIKFWEEIKNLISSKS

References

No reference