9sphn-m4sjq0

Sphingomonas sp. MM-1. Uncharacterized protein

Comment

Relationship

Family : Duf_3089

Block : X

Position in NCBI Life Tree : Sphingomonas sp. MM-1

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MHCTTGAPTLPARRFLYVIAGLIVLTLAAAFGWNIFQDRL
MRTAFVPSVP FTAPSDAGAPDYAAASAWLARPDLPDDPS
RFTVADIARAARPEVAVFYVP PTSYMKRDRWNAPLDDAD
ANQRLGLFASSQASAFNGMGAVWAPRYRQATL GAFLAGN
ADAAAAIDFAYRDVARAFDAFLAQIPASRPILLAGHSQGS
LHL MRLMAEKVAGKPVAKRIVAAYVIGWPVSETADIPAM
GLPGCTGPGQAGCV LSWQSYAEPADTHGVQAVYDATPGL
TGAPRKGTPMLCVNPLTGAPGTAAL PGANRGALVPDAEL
KGAELKPALVPARCDASGFLLIGAAPEGYSGYVLPG GNF
HVFDYALFWANIRADAEARARTFLGR

References

Title : Complete Genome Sequence of the gamma-Hexachlorocyclohexane-Degrading Bacterium Sphingomonas sp. Strain MM-1 - Tabata_2013_Genome.Announc_1_e00247
Author(s) : Tabata M , Ohtsubo Y , Ohhata S , Tsuda M , Nagata Y
Ref : Genome Announc , 1 : , 2013
Abstract : Tabata_2013_Genome.Announc_1_e00247
ESTHER : Tabata_2013_Genome.Announc_1_e00247
PubMedSearch : Tabata_2013_Genome.Announc_1_e00247
PubMedID: 23682148
Gene_locus related to this paper: 9sphn-m4s0a2 , 9sphn-m4sjq0 , 9sphn-m4s4n0 , 9sphn-m4rwk9 , 9sphn-m4s1q7