Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: chltf-g2led8

Chloracidobacterium thermophilum (strain B). Uncharacterized protein

Relationship
Family|ABHD18
Block| X
Position in NCBI Life Tree|Chloracidobacterium thermophilum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Acidobacteria: N E > Blastocatellia: N E > Chloracidobacterium: N E > Chloracidobacterium thermophilum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP002514
1 UniProt : G2LED8
1 UniProt : G2LED8
1 Interpro : G2LED8
1 Pfam : G2LED8
1 PIRSF : G2LED8
1 SUPERFAM : G2LED8
Sequence
Graphical view for this peptide sequence: chltf-g2led8
Colored MSA for ABHD18 (raw)
MLKRLIQSWELRLSKVDRHRRASPFAWGLDHLTSHSEHLPAPLPVADFPH
PPDFLREYVRQTLAAAERFFTPPPLAQWHLHDGWLTFPSSIQTPDEPNNL
AWARYFPVRERPGATTRPPVVLVLPQWNADYASHVSVCQGLNAFGIASVR
LSLPYHGSRRPVHQVRADYMVSPNLGRTLQAVRQAVHEVRLVLDWLESQG
YHRFGIIGTSIGSCVAFLAYAFDPRLQVAAFNHVSSYFADVVWTGISTSH
VRAGLEQHVTRHDLREYWLPISPFPYIERLGRPENRSKKTLLIAARYDMT
FLPHLTRHALSEFERHRAPYTSAWMYCGHYTTGETPFKFHDGYLMINHMR
KHLNPGGHVVRQALKSQLPAVLRPRSRALRPPA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLKRLIQSWELRLSKVDRHRRASPFAWGLDHLTSHSEHLPAPLPVADFPH
PPDFLREYVRQTLAAAERFFTPPPLAQWHLHDGWLTFPSSIQTPDEPNNL
AWARYFPVRERPGATTRPPVVLVLPQWNADYASHVSVCQGLNAFGIASVR
LSLPYHGSRRPVHQVRADYMVSPNLGRTLQAVRQAVHEVRLVLDWLESQG
YHRFGIIGTSIGSCVAFLAYAFDPRLQVAAFNHVSSYFADVVWTGISTSH
VRAGLEQHVTRHDLREYWLPISPFPYIERLGRPENRSKKTLLIAARYDMT
FLPHLTRHALSEFERHRAPYTSAWMYCGHYTTGETPFKFHDGYLMINHMR
KHLNPGGHVVRQALKSQLPAVLRPRSRALRPPA


Reference
    Title: Complete genome of Candidatus Chloracidobacterium thermophilum, a chlorophyll-based photoheterotroph belonging to the phylum Acidobacteria
    Garcia Costas AM, Liu Z, Tomsho LP, Schuster SC, Ward DM, Bryant DA
    Ref: Environ Microbiol, 14:177, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer