alceu-tfe1

Alcaligenes eutrophus, Cupriavidus necator (Ralstonia eutropha) Dienelactonehydrolase (dlh I)

Comment

"Other strains: Cupriavidus pinatubonensis (strain JMP134 \/ LMG 1197) (Alcaligenes eutrophus) (Ralstonia eutropha), Burkholderia sp. JRB1" || "Cis-2-chlorodiene lactone hydrolase from Burkholderia sp. JRB1. sequence identical Trembl Q8VRJ9. (TfdEI and TfdEII) located on plasmid pJP4 of Cupriavidus necator JMP134"

Relationship

Family : Dienelactone_hydrolase

Block : X

Position in NCBI Life Tree : Ralstonia eutropha

Molecular evidence

No mutation

No structure

No kinetic

No disease

No inhibitor

Database

Sequence

Peptide

MLSDGVEITSRSGGRFGAYLGKPTTDSAPIVVIAQEIFGI
TPFIRETVEW LVGAGFGCVCPDLYWRQAPNIELDANVPS
EREQALALFRDFDMEAGVNDL SCAIEYARALPFSNGRVA
VVGYCLGGALAFDVAARSLADCSIGYYGVGLE KKVSLVP
AITRPAMFHMGTKDHYVTEEARSILEEHFGRNKNLSLHWY
PVG HSFARSSSPNFDQAATTVANARTLELLAMLKDPS

References

Title : Two structurally different dienelactone hydrolases (TfdEI and TfdEII) from Cupriavidus necator JMP134 plasmid pJP4 catalyse cis- and trans-dienelactones with similar efficiency - Kumar_2014_PLoS.One_9_e101801
Author(s) : Kumar A , Pillay B , Olaniran AO
Ref : PLoS ONE , 9 :e101801 , 2014
Abstract : Kumar_2014_PLoS.One_9_e101801
ESTHER : Kumar_2014_PLoS.One_9_e101801
PubMedSearch : Kumar_2014_PLoS.One_9_e101801
PubMedID: 25054964
Gene_locus related to this paper: alceu-tfe1 , alceu-tfe2

Title : Genetic organization of the catabolic plasmid pJP4 from Ralstonia eutropha JMP134 (pJP4) reveals mechanisms of adaptation to chloroaromatic pollutants and evolution of specialized chloroaromatic degradation pathways - Trefault_2004_Environ.Microbiol_6_655
Author(s) : Trefault N , De la Iglesia R , Molina AM , Manzano M , Ledger T , Perez-Pantoja D , Sanchez MA , Stuardo M , Gonzalez B
Ref : Environ Microbiol , 6 :655 , 2004
Abstract : Trefault_2004_Environ.Microbiol_6_655
ESTHER : Trefault_2004_Environ.Microbiol_6_655
PubMedSearch : Trefault_2004_Environ.Microbiol_6_655
PubMedID: 15186344
Gene_locus related to this paper: alceu-tfe1 , alceu-tfe2

Title : Organization and sequence analysis of the 2,4-dichlorophenol hydroxylase and dichlorocatechol oxidative operons of plasmid pJP4 - Perkins_1990_J.Bacteriol_172_2351
Author(s) : Perkins EJ , Gordon MP , Caceres O , Lurquin PF
Ref : Journal of Bacteriology , 172 :2351 , 1990
Abstract : Perkins_1990_J.Bacteriol_172_2351
ESTHER : Perkins_1990_J.Bacteriol_172_2351
PubMedSearch : Perkins_1990_J.Bacteriol_172_2351
PubMedID: 2185214
Gene_locus related to this paper: alceu-tfe1