arath-T26I12.70

Arabidopsis thaliana (Mouse-ear cress) AtMAGL11 lipase-like protein At3g55190

Comment

"AtMAGL11 monoacylglycerol lipase, Has no MAGL activity, targeted to the endoplasmic reticulum and\/or Golgi network. Kim et al.2016"

Relationship

Family : Monoglyceridelipase_lysophospholip

Block : X

Position in NCBI Life Tree : Arabidopsis thaliana

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MAHVDGQVGYSEEFIENSRGMQLLTCKWFPVNQEPRALIF
FCHGYAIDCS TTFKDIAPKFAKEGFAVHGIEYEGHGRSS
GLSVYIDNFDLLIDDVSSHFS KISEMGDNTKKKRFLMGE
SMGGAVVLLLHRKKPEFWDGGILIAPMCKIAE EMKPSRM
VISMINMVTNLIPSWKSIIHGPDILNSAIKLPEKRHEIRT
NPN CYNGWPRMKTMSELFRISLDLENRLNEVTMPFIVLH
GEDDKVTDKGGSKL LYEVALSNDKTLKLYPEMWHSLLFG
EPPENSEIVFNDIVQWMQTRITTLQ VKANNHEAKTSNLI
TSDSV

References

Title : Molecular and biochemical characterizations of the monoacylglycerol lipase gene family of Arabidopsis thaliana - Kim_2016_Plant.J_85_758
Author(s) : Kim RJ , Kim HJ , Shim D , Suh MC
Ref : Plant J , 85 :758 , 2016
Abstract : Kim_2016_Plant.J_85_758
ESTHER : Kim_2016_Plant.J_85_758
PubMedSearch : Kim_2016_Plant.J_85_758
PubMedID: 26932457
Gene_locus related to this paper: arath-At1g18360 , arath-At2g47630 , arath-At5g11650 , arath-At5g16120 , arath-AT5G19290 , arath-F2G14.100 , arath-F12L6.7 , arath-F12L6.8 , arath-F14G24.3 , arath-T5M16.2 , arath-T9L24.33 , arath-T19D16.3 , arath-T26I12.60 , arath-T26I12.70