bacco-a0a0b5wsq6

Bacillus coagulans highly thermostable carboxyl esterase

Comment

"Other strains: Weizmannia coagulans (Bacillus coagulans) DSM 1 = ATCC 7050"

Relationship

Family : Monoglyceridelipase_lysophospholip

Block : X

Position in NCBI Life Tree : Bacillus coagulans

Molecular evidence

No mutation

No kinetic

No disease

No inhibitor

Database

Sequence

Peptide

MAFQELSFQSFNGKDNVKAWIYTPIRKPRGIVQVVHGFGE
HSRRYLHMIL KFNEAGFVVAADDHVGHGKTAYDSGNWGD
WGDKGYMTMAEDEHTLRKIVQ EQYPDLPYFMFGHSMGSM
IARGYAATHGAGLSGLILCGTSGRFPNASKLL PVLKNLI
YEGKGQETDLSYLEELMGWMTERIEQPKTPNDWISSDPDI
VAD HANDPFNNFTTPPNIRSLYYFVQMMEIIVGTEWAEK
VPVSIPIYNIAGDQ DPVGQYGEGVYAVSNWLVQTGHHVK
TKVYPGHRHEIHNDRDIRDEVEEGI ISFINGIIVK

References

Title : A stereospecific carboxyl esterase from Bacillus coagulans hosting nonlipase activity within a lipase-like fold - De Vitis_2018_FEBS.J_285_903
Author(s) : De Vitis V , Nakhnoukh C , Pinto A , Contente ML , Barbiroli A , Milani M , Bolognesi M , Molinari F , Gourlay LJ , Romano D
Ref : Febs J , 285 :903 , 2018
Abstract : De Vitis_2018_FEBS.J_285_903
ESTHER : De Vitis_2018_FEBS.J_285_903
PubMedSearch : De Vitis_2018_FEBS.J_285_903
PubMedID: 29278448
Gene_locus related to this paper: bacco-a0a0b5wsq6

Title : Enhanced enantioselectivity of Bacillus coagulans in the hydrolysis of 1,2-O-isopropylidene glycerol esters by thermal knock-out of undesired enzymes - Romano_2005_Tetrahedron.Asymmetry_16_841
Author(s) : Romano D , Falcioni F , Mora D , Molinari F , Buthe A , Ansorge-Schumacher M
Ref : Tetrahedron Asymmetry , 16 :841 , 2005
Abstract : Romano_2005_Tetrahedron.Asymmetry_16_841
ESTHER : Romano_2005_Tetrahedron.Asymmetry_16_841
PubMedSearch : Romano_2005_Tetrahedron.Asymmetry_16_841
PubMedID:
Gene_locus related to this paper: bacco-a0a0b5wsq6