bacmy-c3b7j4

Bacillus mycoides, Bacillus pseudomycoides Uncharacterized protein

Comment

"Other strains: Bacillus mycoides (Rock3-17) Bacillus pseudomycoides DSM 12442"

Relationship

Family : Proline_iminopeptidase

Block : X

Position in NCBI Life Tree : Bacillus mycoides Rock3-17

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MTINKHQQSLLIRGQDVNQPILLCCHGGPGTAQIGFIRHF
QKDLEKHFIV VNWDQRGAGKSFSWRDIKAPFTIEQFVLD
ALEVIKYLLSRFKKQKLFLAG HSWGSIIGLQIANQYPEY
IEAYIGIGQIVHMKQNEELLYQHLIHSAKKHG HERALTS
LTKLGKPPFLDMRRLIIQRKWLGTFGGAVQNGTSFSFIRK
GLF SSEYTLLDWVRFLAGNMKSGALWEEMLTVDFFSSIS
KLSVPVYFCSGRFD YQTPYALVQQYCDTIQAPIKKMIWF
PNSAHSPNLEEPKLFAKSLRSIKQE LSFLH

References