bacsu-MYCC

Bacillus subtilis mycc Mycosubtilin synthase subunit C Thioesterase domain

Comment

"Other strains: Bacillus subtilis subsp. spizizenii Strains: ATCC 6633\; ATCC 23059 \/ NRRL B-14472 \/ W23)"

Relationship

Family : Thioesterase

Block : X

Position in NCBI Life Tree : Bacillus subtilis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

TGDESLKTLQLKQQLQNKLPAYMIPAYFVQIEEMPLTANG
KIDREALPAP DGNMLAGTEYAAPRTLIEKQLAEIWKEVL
AHSELGIKDNFFDVGGHSLKV LQLVDQINKVMGIKLHYH
VVYEAPTIETMAHAIQAAALPSKTENVFVKLN QNGSIPV
FCFPPLIGYGLVYNEMANRLDGDCVVYAADFTEDPSYKKP
IID RFAESMIDIQEQGPFVLLGYSSGSNLAFEVAKALEQ
RGRTVSDVIMLDSQ ITTSVTHLSEKEVEEIIHLNLDIIP
VYYRELLTIPSIKEKIRGYLAYHNQ LINSGTINANIHHL
LCDDMTERGWTHSTAHNYKEYELKGDHVTIFDPQYI EEN
MSTIRSIMKCIEEQQLGELVPHEQLSYMSRTKSDRT

References

Title : The mycosubtilin synthetase of Bacillus subtilis ATCC6633: a multifunctional hybrid between a peptide synthetase, an amino transferase, and a fatty acid synthase - Duitman_1999_Proc.Natl.Acad.Sci.U.S.A_96_13294
Author(s) : Duitman EH , Hamoen LW , Rembold M , Venema G , Seitz H , Saenger W , Bernhard F , Reinhardt R , Schmidt M , Ullrich C , Stein T , Leenders F , Vater J
Ref : Proc Natl Acad Sci U S A , 96 :13294 , 1999
Abstract : Duitman_1999_Proc.Natl.Acad.Sci.U.S.A_96_13294
ESTHER : Duitman_1999_Proc.Natl.Acad.Sci.U.S.A_96_13294
PubMedSearch : Duitman_1999_Proc.Natl.Acad.Sci.U.S.A_96_13294
PubMedID: 10557314
Gene_locus related to this paper: bacsu-MYCC