bacsu-SRFC

Bacillus subtilis and Bacillus amyloliquefaciens putative surfactin synthetase (fragment)

Comment

"Other strains: Bacillus subtilis, Bacillus amyloliquefaciens (strain FZB42)"

Relationship

Family : Thioesterase

Block : X

Position in NCBI Life Tree : Bacillus subtilis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

VKDAVVVADRHESGDASINAYLVNRTPLSADDVKRHLKKQ
LPAYMVPQTF TFLEELPLTTNGKVNKRQLPKPDQAQPAK
EWIGPRNATEETIAHIWSDIL GRQQIGIHDDFFALGGHS
LKAMTAASRIKKELGADIPVQLLFEATTIADI AGYLLHG
EEKGMKDLTIMNKNQSDTLFAFPPVLGYGLMYQPLAKQLS
GYK ICAFDFIEEDNRIERYTELINQLQPEGPVKLFGYSA
GCTLAFETAKQLEA GRRKVERLIMVDSYKKQGVSDLEGR
TVESDVQALMKVNRDNEALNNEAVK EGLAKKTNAFYSYF
VHTVSTGTVNADIDLLTSEPDFAMPPWLASWEEATT GEY
RVKKGCGTHAEMLQGECLERNAAYLLEFLKKEHPKLTTSR

References

Title : Comparative analysis of the complete genome sequence of the plant growth-promoting bacterium Bacillus amyloliquefaciens FZB42 - Chen_2007_Nat.Biotechnol_25_1007
Author(s) : Chen XH , Koumoutsi A , Scholz R , Eisenreich A , Schneider K , Heinemeyer I , Morgenstern B , Voss B , Hess WR , Reva O , Junge H , Voigt B , Jungblut PR , Vater J , Sussmuth R , Liesegang H , Strittmatter A , Gottschalk G , Borriss R
Ref : Nat Biotechnol , 25 :1007 , 2007
Abstract : Chen_2007_Nat.Biotechnol_25_1007
ESTHER : Chen_2007_Nat.Biotechnol_25_1007
PubMedSearch : Chen_2007_Nat.Biotechnol_25_1007
PubMedID: 17704766
Gene_locus related to this paper: baca2-a7z1n9 , baca2-a7z2m6 , baca2-a7z3i0 , baca2-a7z7y5 , baca2-a7z8b1 , baca2-a7z811 , baca2-a7z924 , bacam-q1rs52 , bacam-q1rs69 , bacam-q70jx5 , bacas-e1ukt2 , bacsu-SRFC , bacsu-SRFD , bacsu-YVAK , baca2-a7z0n6

Title : Structural and functional characterization of gene clusters directing nonribosomal synthesis of bioactive cyclic lipopeptides in Bacillus amyloliquefaciens strain FZB42 - Koumoutsi_2004_J.Bacteriol_186_1084
Author(s) : Koumoutsi A , Chen XH , Henne A , Liesegang H , Hitzeroth G , Franke P , Vater J , Borriss R
Ref : Journal of Bacteriology , 186 :1084 , 2004
Abstract : Koumoutsi_2004_J.Bacteriol_186_1084
ESTHER : Koumoutsi_2004_J.Bacteriol_186_1084
PubMedSearch : Koumoutsi_2004_J.Bacteriol_186_1084
PubMedID: 14762003
Gene_locus related to this paper: bacam-q70jx5 , bacam-q70k06 , bacsu-q6yk39 , bacsu-SRFC , bacsu-SRFD