cerat-a0a2k5mjc6

Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). Pancreatic lipase

Comment

Relationship

Family : Pancreatic_lipase

Block : L

Position in NCBI Life Tree : Cercocebus atys

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

No Genbank

Sequence

Peptide

MLPPWTLSLLLLATVRGKEICYGQLGCFSDEKPWAGILQR
PTKLLPWSPE DIDTRFLLYTNENPNDFQLITGTEPDTIE
ASNFQLDRKTRFIIHGFLDQG EDSWPSDMCKKMFEVEKV
NCICVDWRHGSHTMYTQAVQNIRVVGAETAVL IQTLSTQ
LGYSPEDVHLIGHSLGAHTAAEAGRRLGGRVGRITGLDPA
EPC FQGAPEEVRLDPSDAMFVDVIHTDSAPIVPSLGFGM
SQKVGHLDFFPNGG EDMPGCQKNMLSTVIDIDGIWEGIS
NFAACNHLRSFEYYSSSILNPDGFL GYPCASYNEFQENN
CFPCPAEGCPKMGHYADQFEGKTSAVEQTFFLNTGE SGN
FTSWRYKVSVTLSGKENVNGYIRIALYGSNGNSKQYEIFK
GSLKPDA SHMHAIDVDLNVGKIQKVKFLWNNHVINLFKP
KLGASHITVQSGEDGTEY NFCSSDTVEENVLQSLYPC

References

No reference