chlsb-a0a0d9r294

Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). Uncharacterized protein

Comment

Relationship

Family : Lipase_3

Block : L

Position in NCBI Life Tree : Chlorocebus sabaeus

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MPGIVVFRRRWSVGSDDLVLPAIFLFLLHTTWFVILSVVL
FGLVYNPHEA CSLNLVDHGRGYLGILLSCMIAEMAIIWL
SMRGGILYTEPRDSMQYVLYV RLAILVIEFIYAIVGIVW
LTQYYTSCNDLTAKNVTLGMVVCNWVVILSVC ITVLCVF
DPTGRTFVKLRATKRRQRNLRTYNLRHRLEEGQATSWSRR
LKV FLCCTRTKDSQSDAYSEIAYLFAEFFRDLDIVPSDI
IAGLVLLRQRQRAK RNAVLDEANNDILAFLSGMPVTRNT
KYLDLKNSQEMLRYKEVCYYMLFAL AAYGWPMYLMRKPA
CGLCQLARSCSCCLCPARPRFAPGVTIEEDNCCGCN AIA
IRRHFLDENMTAVDIVYTSCHDAVYETPFYVAVDHDKKKV
VISIRGT LSPKDALTDLTGDAERLPVEGHHGTWLGHKGM
VLSAEYIKKKLEQEMVLS QAFGRDLGRGTKHYGLIVVGH
SLGAGTAAILSFLLRPQYPTLKCFAYSPP GGLLSEDAME
YSKEFVTAVVLGKDLVPRIGLSQLEGFRRQLLDVLQRSTK
PKWRIIVGATKCIPKSELPEEVEVTTLASTRLWTHPSDL
TIALSASTPLY PPGRIIHVVHNHPAEQCCCCEQEEPTYF
AIWGDNKAFNEVIISPAMLHEH LPYVVMEGLNKVLENYN
KGKTALLSAAKVMVSPTEV

References

No reference