durzi-a0a6p5xhu8

Durio zibethinus (Durian). protein EDS1

Comment

Relationship

Family : Plant_lipase_EDS1-like

Block : L

Position in NCBI Life Tree : Durio zibethinus

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MDSHTLGEITGFREELIKKACSIAMAAHKSQTKPYIAEKS
RTSSDVLFSF PGSWSVGHWFTRQPFGEIKVDQSELLSPM
GNDKVATSLRSIGCDELATVN EGFLRRLEMILSNSSLQK
EVEKANTEQKQIVFTGHSSGGAIAILATVWFL EQYFKPK
KTGMSPLCVTFGSPFVADFIFNHALRRENWSNYFLHFVMR
YDI VPRVLFAPLSSMQRELEQILYLLNQKARNSIQGSIA
EASKFYQTVMRNAS ALASHAACQLMGNANPILETVASFI
NLSPYRPSGTFVFCTGNGKLVVVRN ADAILQLLFYSSQL
CSENELEAIAERSLNNHFGYRSELQESLSKQNVVNL DHL
EGLPLSSNGAAAENIAINMALTDLGLSTRARLCLRAAGEQ
EKQKLSN QQIMDKKKKDIDKGLAVLEEYKNKSAVCQVGY
YDAFKISKDVDDFQANVK RLELTGIWDEIIEMLNRHELP
DGFESEKDWVELATKYRRIVEPLDIANYY RHAKNEDTGP
YMHKGRPRRYRYTQRWLEHALRMPVGSSEESCFWAEVEEL
LLLYQGKDFKPGAFEDIRERILNLERKLEEWIHGNQISN
DVFLEGSTFTK WWVSLPHQHKYVSRIRGLMNR

References

Title : The draft genome of tropical fruit durian (Durio zibethinus) - Teh_2017_Nat.Genet_49_1633
Author(s) : Teh BT , Lim K , Yong CH , Ng CCY , Rao SR , Rajasegaran V , Lim WK , Ong CK , Chan K , Cheng VKY , Soh PS , Swarup S , Rozen SG , Nagarajan N , Tan P
Ref : Nat Genet , 49 :1633 , 2017
Abstract : Teh_2017_Nat.Genet_49_1633
ESTHER : Teh_2017_Nat.Genet_49_1633
PubMedSearch : Teh_2017_Nat.Genet_49_1633
PubMedID: 28991254
Gene_locus related to this paper: durzi-a0a6p5xhu8