lacsa-a0a2j6mhc5

Lactuca sativa (Garden lettuce). protein bem46-like

Comment

Relationship

Family : ABHD13-BEM46

Block : X

Position in NCBI Life Tree : Lactuca sativa

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MVSYKSLLIYGVGGIAVAGMALLVAFQEKLVYVPVLPGLT
KSYPITPDRL RLIFEDVWLTSSDGVRLHSWFIKFSPNST
GPTILFFQENAGNIAHRLEMV RIMLQNLHCNVFMLSYRG
YGASDGYPSQEGITMDAQAALDHLSQRTDIDT TQIVVFG
RSLGGAVGAVVTKNNPDKVAALILENTFTSILDMAGVLLP
FLK YFIGGSSSNSKTPKILNFVVRSPWNTIDVIGQIKQP
ILFLSGLQDEMIPP SHMEMLYAKAALHNKRCIFVDFPNG
KHMDTWLAGGDEYWEAVQTFLQENV LENGNGMF

References

Title : Genome assembly with in vitro proximity ligation data and whole-genome triplication in lettuce - Reyes-Chin-Wo_2017_Nat.Commun_8_14953
Author(s) : Reyes-Chin-Wo S , Wang Z , Yang X , Kozik A , Arikit S , Song C , Xia L , Froenicke L , Lavelle DO , Truco MJ , Xia R , Zhu S , Xu C , Xu H , Xu X , Cox K , Korf I , Meyers BC , Michelmore RW
Ref : Nat Commun , 8 :14953 , 2017
Abstract : Reyes-Chin-Wo_2017_Nat.Commun_8_14953
ESTHER : Reyes-Chin-Wo_2017_Nat.Commun_8_14953
PubMedSearch : Reyes-Chin-Wo_2017_Nat.Commun_8_14953
PubMedID: 28401891
Gene_locus related to this paper: lacsa-a0a2j6jnd3 , lacsa-a0a2j6l6y4 , lacsa-a0a2j6mjs5 , lacsa-a0a2j6mk82 , lacsa-a0a2j6k5z4 , lacsa-a0a2j6mk08 , lacsa-a0a2j6mhc5 , lacsa-a0a2j6m8d0 , lacsa-a0a2j6mdb6 , lacsa-a0a2j6mdh6 , lacsa-a0a2j6jnf0 , lacsa-a0a2j6mji4 , lacsa-a0a2j6ke81 , lacsa-a0a2j6jip3 , lacsa-a0a2j6jir5 , lacsa-a0a2j6ksa7 , lacsa-a0a2j6l4a3