linus-i6xnh8

Linum usitatissimum (Flax) (Linum humile). Pectinacetylesterase

Comment

Relationship

Family : Pectinacetylesterase-Notum

Block : X

Position in NCBI Life Tree : Linum usitatissimum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MEPLMVLTATVALLCFTVCSADRVGVPMTLVHAAAAKGAL
CLDGSLPAYH LQRGFGAGANNWLLQFEGGGWCNTVDSCW
ERAKTRRGSTSLMVKLENFSG ILSNNASLNPDFYNWNRV
KLRYCDGASFTGDSKIVNGSSVLYFRGQRIWD AIITDLL
PKGLANARKALLSGCSAGGLSVFHHCEDFSRRKDVASNYT
MRA FFEDLVTLQCFFPQYALRYITTPFFLLNSAYDVYQI
NHILVPPSADVHGS WRGCKTRISGCTPTQIEDLQGLRIE
MLKASLAFYRGVDMNGMFINSCFSH CQSEFQPTWFDLNS
PMIQNKTIAEAVGDWYFGRKV

References

Title : The genome of flax (Linum usitatissimum) assembled de novo from short shotgun sequence reads - Wang_2012_Plant.J_72_461
Author(s) : Wang Z , Hobson N , Galindo L , Zhu S , Shi D , McDill J , Yang L , Hawkins S , Neutelings G , Datla R , Lambert G , Galbraith DW , Grassa CJ , Geraldes A , Cronk QC , Cullis C , Dash PK , Kumar PA , Cloutier S , Sharpe AG , Wong GK , Wang J , Deyholos MK
Ref : Plant J , 72 :461 , 2012
Abstract : Wang_2012_Plant.J_72_461
ESTHER : Wang_2012_Plant.J_72_461
PubMedSearch : Wang_2012_Plant.J_72_461
PubMedID: 22757964
Gene_locus related to this paper: linus-i6xnh8