nicat-d2stm8

Nicotiana attenuata (Coyote tobacco) Glycerolipase A1 GLA1 NaGLA1

Comment

Relationship

Family : Plant_phospholipase

Block : L

Position in NCBI Life Tree : Nicotiana attenuata

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

Database

Sequence

Peptide

MQVAVATNVHFFQARRSSFKYCNGSSPLNPIPRATAVNVQ
CLKTVATPPT STTEMTKKHLSNLEMLLQKQSQPHPMDSA
EPIIQEIKQRKTGENRGRNML EGLNLARIWPEMKAAEEY
SPRHLVKLHRMLSSKSMEYSPRNNLGTRWREY HGCKDWL
GLIDPLDENLRRELVRYGEFIQAAYHCFHSNPATSEKENA
DVA RNVSLPDRSYKVTKSLYATSSVGLPKWVDDVAPDLG
WMTQRSSWIGYVAV CDDKTEIQRMGRRDIVIALRGTATC
LEWGENFRDVLVQMPGKNDSVEGQP KVECGFLSLYQTGG
NKIPSLAESVVNEVKRLIEMYKGESLSITVTGHSLG AAL
ALLVADDVSTCTPDSPPVAVFTFGGPRVGNKGFANRLESK
NVKVLRI VNKQDVITKVPGMFVSEALDKKLREKGAAGVL
NLLDNSMPWAYSHVGTEL RVDTTKSPFLKPDADVACCHD
LEAYLHLVDGYLGSNESFRPNAKRSLVKL LTEQRTNIKK
LYNSKGKDLSSLNLNSEFNFPRPSCLPSPSVLPSPSA

References

Title : Identification and characterization of GLYCEROLIPASE A1 for wound-triggered JA biosynthesis in Nicotiana benthamiana leaves - Holtsclaw_2024_Plant.Mol.Biol_114_4
Author(s) : Holtsclaw RE , Mahmud S , Koo AJ
Ref : Plant Mol Biol , 114 :4 , 2024
Abstract : Holtsclaw_2024_Plant.Mol.Biol_114_4
ESTHER : Holtsclaw_2024_Plant.Mol.Biol_114_4
PubMedSearch : Holtsclaw_2024_Plant.Mol.Biol_114_4
PubMedID: 38227103
Gene_locus related to this paper: nicat-d2stm8 , nicat-a0a1j6j5f9