nicbe-Q8S3U2

Nicotiana benthamiana eds1-like protein

Comment

Relationship

Family : Plant_lipase_EDS1-like

Block : L

Position in NCBI Life Tree : Nicotiana benthamiana

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MVRIEEGREVKDELIKKACNLAMEAHSLSSGKPYIFKKKS
GSMDVFLAFA GNWSVDGWYSCSTSFGEKKSSFPSLKSVG
TDEVAMVNEAFASRFEHILNN SSLKNEVEKAMSEGKQIV
FAGHSSGGPIAILAALWCLEHCCTRPNDNLVC PYCITFG
CPLVGDRIWSHALMRENWARYFIHFVTKYDIVPRMMLAPL
SSI QEWLQAIFDFINPKSRNYQHEVVVRSYDASKNFFMT
VMRSASSVASYAAC NLKGCTNLLLETVSNIVQLSPYRPF
GTYIFCTGNGKLVVVENPDAVLQLL FYCAQMSSETEVEE
VVTRSLNEHLLYRKEMQESLEMQDVVHLNNLTDIPL SSN
AIALASDEVVTMNLALNDLGLSTRARLCLRAAGQWEKQKR
KNEEKID GNKNSIMEGLSKIQEYQTKCDIQKVGYYDAFK
LQETIDDFNANVKRLELA GIWDEIIEMLKRYELPDSFEG
RKEWIKLGTQFRRQVEPLDIANYYRHLKN EDTGPYMIRA
RPKRYRFTQRWLEHEERVQTGERSESCFWAEVEELRNKPI
MEVQNRILSLETKAWDWSQSGLLGDDVFFPESTFTKWWK
QLPTQHRMTSW ISGKVNS

References

Title : An EDS1 orthologue is required for N-mediated resistance against tobacco mosaic virus - Peart_2002_Plant.J_29_569
Author(s) : Peart JR , Cook G , Feys BJ , Parker JE , Baulcombe DC
Ref : Plant J , 29 :569 , 2002
Abstract : Peart_2002_Plant.J_29_569
ESTHER : Peart_2002_Plant.J_29_569
PubMedSearch : Peart_2002_Plant.J_29_569
PubMedID: 11874570
Gene_locus related to this paper: nicbe-Q8S3U2