nicbe-b3vmr4

Nicotiana benthamiana Epoxide hydrolase

Comment

Relationship

Family : Epoxide_hydrolase

Block : X

Position in NCBI Life Tree : Nicotiana benthamiana

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MESIEHRTVNVNGINMHVAEKGKGPVVLFLHGFPELWYTW
RHQLVAFADL GYRAVAPDLRGYGDTDAPADVASYTCFHV
VGDLVALIESLGVESVFLVAH DWGAMIGWYLCLFRPDLV
KAYVCLSVPFRPRHPKMKPIPTMRAFFGDDYY MCRFQDP
RMEDEIAKNGSEAVLKKILTDRKPGPPCLPKENPFGISPD
SKL PSWLSQDDLKYYSTKFDQKGFTGGLNYYRALDLNWE
LTAAWTGAKAKVPV KFMVGELDLVYTTPGMKEYVHGGGF
KKDVPMLDEDVVVMEGAAHFINQER AQETNSHIHNFINK
F

References

Title : The involvement of two epoxide hydrolase genes, NbEH1.1 and NbEH1.2, of Nicotiana benthamiana in the interaction with Colletotrichum destructivum, Colletotrichum orbiculare or Pseudomonas syringae pv. tabaci. - Wijekoon_2008_Funct.Plant.Biol_35_1112
Author(s) : Wijekoon CP , Goodwin PH , Hsiang T
Ref : Funct Plant Biol , 35 :1112 , 2008
Abstract : Wijekoon_2008_Funct.Plant.Biol_35_1112
ESTHER : Wijekoon_2008_Funct.Plant.Biol_35_1112
PubMedSearch : Wijekoon_2008_Funct.Plant.Biol_35_1112
PubMedID:
Gene_locus related to this paper: nicbe-b3vmr3 , nicbe-b3vmr4 , nicta-epoxy