nillu-a0a1s5vg83

Nilaparvata lugens (Brown planthopper). Pancreatic lipase

Comment

Relationship

Family : Pancreatic_lipase

Block : L

Position in NCBI Life Tree : Nilaparvata lugens

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MRDILNTTGNVFLQTILYLTNTNFTADNRIDHASLMSTAD
EVLQNSLYNV EKGVDVAVKCYDNLGCYSINPPWTDVSRP
VSKYPEPPEKVSPKYCLYTRH NRHVCQQLVYTNPRTIYR
SYLMPTHKVYFIAHGFLENGEKDWIKNLTSEL LERYDVN
VISVDWGNGSSPPYTQAVANIRLVGTITAHLIHTMSTLVG
LKA EFCHVIGHSLGAHLAGYVGSTLQTKFRQKLGRITGL
DPAEPHFSKTDPIV RLDPTDANYVDIIHSDATPFIRGGL
GMDEPIGHLDFYPNGGENQPGCDKG LMNYVQMEQNSFFK
GVRKFLGCDHVRSLQFFNESVNTQCKFIAIECDTWE NFI
AGECFECSENRICASMGMNSFHTVQRETAGSGVMDSAFSR
NLVKLYT ITGPQPPFCRDLYRIAVSISSSEESLEHDGEV
GQFRIELEGEDGSRTEPL PVFKEQYFKPGEVSRTVVAGS
GVGRVVSAVLHWTHQMFWLLSLRFQTPKV YLGHVEVDYI
VDLKVYSVKLCPDKEEILSGRSIKLHAC

References

Title : Pancreatic lipase-related protein 2 is essential for egg hatching in the brown planthopper, Nilaparvata lugens - Xu_2017_Insect.Mol.Biol_26_277
Author(s) : Xu L , Huang HJ , Zhou X , Liu CW , Bao YY
Ref : Insect Molecular Biology , 26 :277 , 2017
Abstract : Xu_2017_Insect.Mol.Biol_26_277
ESTHER : Xu_2017_Insect.Mol.Biol_26_277
PubMedSearch : Xu_2017_Insect.Mol.Biol_26_277
PubMedID: 28032922
Gene_locus related to this paper: nillu-a0a1s5vg83