papso-cxe1

Papaver somniferum (Opium poppy). Carboxylesterase 1

Comment

Relationship

Family : Plant_carboxylesterase

Block : H

Position in NCBI Life Tree : Papaver somniferum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MADPYEFLMCIHNPEEDTLTRNFPIPATPLDQNTKDISLN
PDRKTSLRIF RPPTKEPPVTKNKLLPIIIYFHGGGFILF
NADSTMNHDFCQSIATHIPAL VVSVDYRLAPENRLPAAY
DDAVDALNWVKDQGLGKLNNSEVWLKEYGDFS KCFIMGC
SSGANVAYHASLRAIEMDLEPAKINGLILHCPFFGSLERT
ESD SKVINNQDLPLAVRDVMWELALPLGSTRDHVYCNPN
IDHDGSSSGNMVGL IERCFVVGFYGDPLIDRQIQLVKML
EEKGVKVETWIEQGGYHGVLCFDPM IRETFLEKLKHFIL
NDEFIY

References

Title : Complete biosynthesis of noscapine and halogenated alkaloids in yeast - Li_2018_Proc.Natl.Acad.Sci.U.S.A_115_E3922
Author(s) : Li Y , Li S , Thodey K , Trenchard I , Cravens A , Smolke CD
Ref : Proc Natl Acad Sci U S A , 115 :E3922 , 2018
Abstract : Li_2018_Proc.Natl.Acad.Sci.U.S.A_115_E3922
ESTHER : Li_2018_Proc.Natl.Acad.Sci.U.S.A_115_E3922
PubMedSearch : Li_2018_Proc.Natl.Acad.Sci.U.S.A_115_E3922
PubMedID: 29610307
Gene_locus related to this paper: papso-cxe1

Title : Engineering biosynthesis of the anticancer alkaloid noscapine in yeast - Li_2016_Nat.Commun_7_12137
Author(s) : Li Y , Smolke CD
Ref : Nat Commun , 7 :12137 , 2016
Abstract : Li_2016_Nat.Commun_7_12137
ESTHER : Li_2016_Nat.Commun_7_12137
PubMedSearch : Li_2016_Nat.Commun_7_12137
PubMedID: 27378283
Gene_locus related to this paper: papso-cxe1

Title : Acetylation serves as a protective group in noscapine biosynthesis in opium poppy - Dang_2015_Nat.Chem.Biol_11_104
Author(s) : Dang TT , Chen X , Facchini PJ
Ref : Nat Chemical Biology , 11 :104 , 2015
Abstract : Dang_2015_Nat.Chem.Biol_11_104
ESTHER : Dang_2015_Nat.Chem.Biol_11_104
PubMedSearch : Dang_2015_Nat.Chem.Biol_11_104
PubMedID: 25485687
Gene_locus related to this paper: papso-cxe2 , papso-cxe1

Title : A Papaver somniferum 10-gene cluster for synthesis of the anticancer alkaloid noscapine - Winzer_2012_Science_336_1704
Author(s) : Winzer T , Gazda V , He Z , Kaminski F , Kern M , Larson TR , Li Y , Meade F , Teodor R , Vaistij FE , Walker C , Bowser TA , Graham IA
Ref : Science , 336 :1704 , 2012
Abstract : Winzer_2012_Science_336_1704
ESTHER : Winzer_2012_Science_336_1704
PubMedSearch : Winzer_2012_Science_336_1704
PubMedID: 22653730
Gene_locus related to this paper: papso-cxe1