patfa-a0a1v4j3h9

Patagioenas fasciata monilis. Phospholipase A1 member A

Comment

Relationship

Family : Phospholipase

Block : L

Position in NCBI Life Tree : Patagioenas fasciata monilis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MVEDLKRKLLVFLAVLLLLSSAQAGNTDRLSGHHCTDFQT
ANFLRGSKLK VRFLLFTSSSPSCGELILTDDGIQNSTFN
TSLETKIIIHGFRALGTKPSW IEELVHAILHTSQVNVIA
VDWVYGSTGAYASAVENVPELALSISQFISKL LALGVSG
TSIHIIGVSLGAHVGGLVGHFHGGQLGRITGLDPAGPKFT
RAS PEERLDPGDALFVEAIHTDADNFGIRIPVGHIDYFV
NGGKDQPGCPRFIS AGYKFLICDHMRAVHLYVSALKHSC
PIVAFPCASHQDFLNGHCLDCADPF LFSCPRIGLLEQAG
LNMRKLPKEVKVYLKTSPSAPFCVHHSLVEFHLQKK RNI
VTSIEITFCSNSTRDTAKITIPKHEETGKRLLAHRVPLCQ
INSVTLK YLPRNQFWRKDESSIVGKFCAVPLPLDSNRTM
LCLPWNVTLPGKTEISYE LPAACA

References

No reference