patfa-a0a1v4jb02

Patagioenas fasciata monilis. Mycophenolic acid acyl-glucuronide esterase, mitochondrial

Comment

Relationship

Family : ABHD10

Block : X

Position in NCBI Life Tree : Patagioenas fasciata monilis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MAVLLSPLRVALGLPVCRLKSSVSFLTRPDRPNLAYHKLK
GRNPGVIFLP GFNSNMNGQKAMALEDFCNSLGHAFIRFD
YTGCGSSDGKFEECTIGKWRK DVLSVLDELAEGPQILVG
SSMGGWLMLHAAIARPDKVAALVGVAAAADHL VTTFQKL
PIEVQKEIEEKGEWKFPTKYNEEGYYSLRYDFIKEAENHC
VLN SPIPVTCPIRLIHGMKDDDVPWQISMQVADRVLSKD
VDVILRKTGQHRMS EKEDTKLLVNTVDDLIDKLATLA

References

No reference