patfa-a0a1v4jdn8

Patagioenas fasciata monilis. Hepatic triacylglycerol lipase

Comment

Relationship

Family : Hepatic_Lipase

Block : L

Position in NCBI Life Tree : Patagioenas fasciata monilis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MKSLQLVSFLLISCIITPANTHGGKKKEALGSQSQHTRTK
KDQQNSETKF RLYTDTTEESCQIFWNQLETLDKCGFNAS
LPLVMIVHGWSVDGVLESWIW KMAAALKSQHKQMNVIIA
DWLTSAHQHYPIAVQNTRYIGQEIADFLEWLE ESIQFSR
SNAHLIGYSLGAHVSGFAGSYISGTNKIGRITGLDPAGPL
FEG MSPTDRLSPDDANFVDAIHTFTKQHMGLSVGIKQPV
AHFDFYPNGGTFQP GCHIMHVYNHIAQYGITGITQTVKC
AHERSVHLFIDSLLHNDKQSTAYWC NDINTFEKGMCLSC
RKNRCNTLGYNIREERLPKSRRLFLKTRAHMPFKVY HYQ
FKIHFINEIQGKQIDPTFTISLTGSKEDAKNLPITVVEGI
NGNKTYS FLITLDTDIGDLIMIKLKWEATAVWENIWDTV
QIIIPWTKGTRRPGLTVK TIRVKAGETQQKMTFCSQSID
NLHLHPAQEKTFVRCEDRFQRQNSKW

References

No reference