patfa-a0a1v4k2k0

Patagioenas fasciata monilis. Abhydrolase domain-containing protein 15

Comment

Relationship

Family : abh_upf0017

Block : X

Position in NCBI Life Tree : Patagioenas fasciata monilis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MVSPEGLVAVAVVLAGLGLLARCLWAGRLEVPGAWGEEEE
EGIPLIAKDG LWRCRLLCKPSALAQHLVRSLGRSVVLRG
GRWSWPRWPQLQMLWQLLQPP EPEPVLARELLQLPDTGL
VALDWLVGPWGTMGAGGGDPSPVLLLIPNAAG KVTGALL
QLGLRALEQGFVPVIFNRRGHNGCPLTTPRFQPFGDPRDL
REA VTYLRCRHPTAPLLAVSEGSGSGLLLAYLGESGSSS
RLAAAACLSPVFSG RDWFEAGMPWLYEWPLLLHLKQGLS
RYAGSLSEAVDVDRLLRSRSLRELE ETLFCRTKSRPTSW
DTYWERNEPLRDADEAAVPVLCICSADDPVRGPPAR SLP
TELFRSSPYFFLLLTPRGGHCGFPRQGQGHCWGHEVVLEY
FKAMAEF LRAEEKRKGPPRPRRSGGPTVEPPVFTWQRSY
TR

References

No reference