patfa-a0a1v4k4m3

Patagioenas fasciata monilis. Alpha/beta hydrolase domain-containing protein 11

Comment

"only c-term ABHD11 n-term CARD"

Relationship

Family : ABHD11-Acetyl_transferase

Block : X

Position in NCBI Life Tree : Patagioenas fasciata monilis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

AVPVAYTEVSGRGDRPPLLMLHGLFGNRGNFQTAAKALVR
GGSGKVLALD ARNHGSSPHSPLMSYEAMSLDVQQLLTHL
GITKCILLGHSMGGKTAMTLA LQRPDLVERLISVDISPV
TTTPVSEFSAYISAMKTVKIPKGLSRSAARQL ADDQLRP
VVQLPQMRQFLLTNLVEVEGRYVWRVNLEAISHHLADIMN
FPP FHKPYPGPALFLGGSNSPYISSKDYPEIQRLFPRAN
VKYIEGAGHIVHQD KFEEFITAVLNFLPPP

References

No reference