patfa-a0a1v4kih0

Patagioenas fasciata monilis. Pancreatic lipase

Comment

Relationship

Family : Pancreatic_lipase

Block : L

Position in NCBI Life Tree : Patagioenas fasciata monilis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MVHDKQEMLAIWLLALFLLNAAEGDEVCYDRIGCFSDDVP
WSGTVERPIY KLPWSPEKIDLHFLLYTRQNPDVYQEISA
TDDGTIASSNFNANRMTRFIV HGFIDKGDENWLYDMCQR
LLSVEDVNCICVDWKKGARCQYTQASNNVRVV GAEIAYF
INVLMEKYGTSLSNIHIIGHSLGSHVAGEAGKRRPGIGRI
TGL DPAQPYFQDTPIEVRLDQSDAEFVDVIHTDTAPTIP
YLGFGMSTAIGHLD FYPNGGREMPGCDKNPISQIVDLDG
IWEGTRDFVACNHLRSYKYYSDSIL YPDGFLGYACASYD
NFEAGSCFPCPQDGCPNMGHYADRFKGKVTNDITKL YLN
TAEAKDFPLWRYKVTMTLSGSRKVSGYANVALYGSGGNTR
QYQIVKG TLQPDETYTSFIDVEINVGTITKVKFLWNNNV
INPTLPTIGAATIIVQSG ENSAEFRFCSSSTVREDVLLT
LNSC

References

No reference